KEGG   Drosophila virilis: Dvir_GJ23510Help
Entry
Dvir_GJ23510      CDS       T01066                                 

Definition
GJ23510 gene product from transcript GJ23510-RA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dvir_GJ23510
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: Other group
  Aur family [Table]
   Dvir_GJ23510
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dvir_GJ23510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 363 aa AA seqDB search
MSHKPNNPTTETLTAAPGCSQTGAQLSKPGTKAMMGAQQKQQITAATAAAGPTKKLNTAV
ANTENQPPSAIPGNSTSTKGNSTDKEKTETEAASAKPKKTWALSNFDIGRQLGRGKFGNV
YLAREKESQFVVALKVLFKRQIGETNVEHQVRREIEIQSHLRHPHILRLYAYFHDDARIY
LVLEYAPQGTLFSALQAQPLKRFDDRQSATYIKALCSALLYLHERDIIHRDIKPENLLLG
HKGVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVLNKPHTKNVDLWSLGVLCFELLVG
HAPFYSKNYEETYKKILKVDYKLPEHVSKAATHLISKLLVLNPQHRMPLDQIMLHPWIIA
HTQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaagccgaacaatcccacgactgaaactttgacggcagcacctggctgcagt
caaactggcgcacaattatcaaagccgggcacaaaggctatgatgggtgcacaacaaaaa
caacagattacagcagcgactgcagcagcaggacctacaaaaaaactaaacacggctgtg
gctaacaccgagaatcaaccgccgtctgcgatccctggaaacagcactagcacaaaaggc
aacagcactgataaagaaaagactgaaacagaagcagcatcagcaaaacccaaaaagaca
tgggcattgagcaactttgacatcggtcgccagctagggcgaggtaaatttggcaacgtg
tatttggcgcgcgaaaaggagtcccagtttgtcgttgcgctgaaggtacttttcaagcgt
cagattggcgagacaaatgtagagcaccaggtgcgacgcgaaattgaaatccaatcgcat
ctaagacatccgcatatattgcgtttgtatgcatattttcatgacgatgcgcgcatctat
ttggttttagaatatgcacctcaaggcacgctgttcagtgctctacaggcgcagccacta
aaacgattcgatgaccgtcagtcggccacatatatcaaggcgctttgctcggcgctgttg
tatttgcatgaacgtgatattatacatcgggacattaagccggagaatcttcttttgggt
cacaaaggggtgttaaagatagcagatttcggctggtctgttcatgagccaaattctatg
cgtatgacgctctgcggcactgttgattatctaccgcccgaaatggtgttaaacaaaccg
cacaccaaaaacgtcgatctatggagcttgggtgtgctatgttttgagctgctggtgggt
catgcgccattctattcgaaaaactatgaggagacatacaaaaagatacttaaggtggac
tataaacttccagaacacgtttccaaagcggcaactcatttaatatccaagctattagtg
ttgaatccccagcatcgaatgccgctagatcagatcatgctgcatccatggattatagct
cacacacaatga

DBGET integrated database retrieval system