KEGG   Drosophila virilis: Dvir_GJ23517Help
Entry
Dvir_GJ23517      CDS       T01066                                 

Definition
GJ23517 gene product from transcript GJ23517-RA
Orthology
K11252  
histone H2B
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaacaagtgggaaggcagccaaaaaggctggtaaggctcagaaaaacatt
accaagaatgacaagaagaagaagcgcaagaggaaggaaagctacgctatctacatttac
aaagtgctcaagcaggtccaccctgacaccggcatttcgtcaaaggcgatgagcataatg
aacagctttgttaacgacattttcgagcgtattgctgccgaggcctcccgtttggctcac
tacaacaaacgctcgactattaccagtcgggaaatccaaaccgcagtacgtcttttgctg
cccggcgaattggccaagcacgctgtcagtgagggaacaaaagcagttacaaagtacacc
agctccaagtaa

DBGET integrated database retrieval system