KEGG   Drosophila virilis: Dvir_GJ23519Help
Entry
Dvir_GJ23519      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
dvi  Drosophila virilis
Brite
Chromosome and associated proteins [BR:dvi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dvir_GJ23519
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dvir_GJ23519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6630835
NCBI-ProteinID: XP_002053111
FlyBase: FBgn0210617
UniProt: B4LVM9
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaacaagtgggaaggcagccaaaaaggctggtaaggctcagaaaaacatt
accaagaatgacaagaagaagaagcgcaagaggaaggaaagctacgctatctacatttac
aaagtgctcaagcaggtccaccctgacaccggcatttcgtcaaaggcgatgagcataatg
aacagctttgttaacgacattttcgagcgtattgctgccgaggcctcccgtttggctcac
tacaacaaacgctcgactattaccagtcgggaaatccaaaccgcagtacgtcttttgctg
cccggcgaattggccaagcacgctgtcagtgagggaacaaaagcagttacaaagtacacc
agctccaagtaa

DBGET integrated database retrieval system