KEGG   Drosophila virilis: Dvir_GJ23531Help
Entry
Dvir_GJ23531      CDS       T01066                                 

Definition
GJ23531 gene product from transcript GJ23531-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dvi  Drosophila virilis
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dvir_GJ23531
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dvir_GJ23531
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dvir_GJ23531
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dvir_GJ23531
   00511 Other glycan degradation
    Dvir_GJ23531
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dvir_GJ23531
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dvir_GJ23531
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ23531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 640 aa AA seqDB search
MNLYYGLVIILALVSITAIGSSSRTFVVDYENDRFLKDGLPFRFISGSFHYFRAHPDTWS
RHLRTMRAAGLNAVTTYVEWSLHNPRDGVYVWNGIADLERFIRLAVDEDLLVILRPGPYI
CAERDMGGFPYWLLNKFPGIQLRTADINYLSEVRIWYAQLMTRIVPYLYGNGGPIIMVQV
ENEYGSYFACDVNYRNWLRDETQSHVKDNAVLFTNDGPTVLRCGKIQNVLATMDFGATTN
LKDIWSKLRRYEPKGPLVNAEYYPGWLTHWTEPMANVSTEAITGTFIDMLESGASVNFYM
FYGGTNFGFTAGANDNGPGNYIADITSYDYDAPMTEAGDPTPKYMALRHIIGRYLPLPDV
PVPQPVPKRAYGIVRLFSCCTLFSREGREKLSTGVVRSAKPKTFEALNQYSGLVLYESWL
PAQFKRDPSVLHVRGLADRGYVYVDNEFVGILARETPIFDLPLSASSGRQLQILVENQGR
LNYGRQLNDFKGLTKDVRLDKQILTNWNMTKYPLESYENLEALITTSTEAAKVGFQEIRK
LKTVLRNGPAIYYGTLTIDSADQLADTYLDMSGWGKGIVFLNGENLGRYWPLVGPQITLY
VPAAVLKVGRNRLILVEYQQTPTAMELQFRDTPILNSRVN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtactatggtttggtgatcatattggctttggtttcaattactgcaatcggc
agcagcagtcgcaccttcgttgtggactatgagaatgatcggtttctgaaggatggactg
ccatttcgcttcatatccggctcctttcattattttcgggctcatcctgatacctggtcg
aggcacttgagaacaatgcgtgccgctggtctcaatgcagtaactacatacgtagaatgg
tccctacacaatccccgcgatggcgtctacgtttggaatggcattgccgacttggaacgc
tttatacgtctggctgtcgacgaggacttgttggtgatactgcgtccaggtccctatatt
tgtgccgagcgcgatatgggcggctttccatactggcttctaaacaagtttcctggtata
caactgcgcacagccgacattaactaccttagtgaggtgcgcatatggtatgcccagcta
atgacacgcattgtgccttatctttatggcaacggtggacccattattatggttcaggtc
gagaacgagtatggttcgtactttgcttgcgacgtaaattatcgcaactggttgcgcgac
gagactcagagccatgttaaggataatgccgtgctgtttaccaacgatggacccactgtg
ctgcgttgcggcaagattcagaatgttttggctacgatggactttggagccacaacaaat
ctcaaggacatctggagcaaactgcgacggtacgaacctaaaggtccgctagtaaatgcc
gagtactatcccggctggctgacgcactggacagagcctatggccaatgtgagcactgag
gcaataacgggaacattcattgatatgctagagagtggagccagtgtcaatttctacatg
ttttatggtggtactaattttggttttacggcgggcgccaatgacaacggacctggtaac
tatatagcagacataaccagctatgattacgacgcacccatgacagaagcgggtgatccc
acgccaaagtacatggcactacgccacattattggcaggtatttaccactgccggatgtg
ccagtaccgcagccggtgcccaaacgggcatacggcatagtcaggctgttcagctgctgt
acgctgttttccagagagggtcgagaaaaactcagtacgggtgttgtgcgctctgcaaag
ccaaaaacttttgaggccctgaaccaatattctggcctggtactgtatgaatcttggttg
cccgcgcagtttaaacgggatccgagtgtgttgcatgtgcgcggcctggcggaccgtggc
tacgtctatgtagacaatgaatttgtaggcatactggcgcgagagacacccatctttgat
ttaccactaagtgctagctcgggtaggcagttacagattctggtcgagaatcagggacgc
cttaactatggaaggcagctgaatgacttcaagggcctcacgaaggatgtgcgcctggac
aaacagatattaaccaactggaatatgaccaagtatccactagaatcgtatgaaaacctg
gaggctctcataaccacgtcgactgaagcggcaaaagttggctttcaagagattagaaaa
ctaaagacggtactacgaaatggaccagccatctattacggcacgttaaccatcgacagc
gccgatcaactggcggacacatatctggatatgtccggctggggaaaaggtattgtcttt
ctaaacggcgagaatctgggccgctactggcctctggttggcccgcaaataacactatat
gtgcccgccgcagttttaaaagtaggcagaaaccgtttgatcctggtggaataccaacag
acgcccactgctatggagctgcagtttcgcgatacgcccattttgaatagcagagtaaat
tag

DBGET integrated database retrieval system