KEGG   Drosophila virilis: Dvir_GJ23587Help
Entry
Dvir_GJ23587      CDS       T01066                                 

Definition
GJ23587 gene product from transcript GJ23587-RA
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dvir_GJ23587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 326 aa AA seqDB search
MQCEDTKRRDKLPIVYSKNYSVRFAGLEKLHPFDAAKGKHIQRLLCAELSLECGDFYDPL
EITKTELLRVHTSKYLKSLKWSANVACIAEVPVLMFLPNFTVQSGYLRPMRYQTAGSILA
GKLALEYGWAINLGGGFHHCCSYKGGGFCPYADITLLLVRLFELESSRVQNAMIVDLDAH
QGNGHERDFKNIEAVYILDMYNAFVYPKDHEAKLSIRCGVELKHLTEDAYYLRQLSRCLM
QALAEFKPDVVIYNAGTDILKGDPLGNLAISADGVIERDRLVFSTFRALGIPIVMLLSGG
YMNSSKHVIADSIVNLQRKGWLSLHS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcgaggacactaagagacgtgataagttgcccatcgtctactccaagaattat
tccgtgcgctttgctggccttgaaaagcttcatcctttcgatgcagccaaaggaaagcat
atacaacggttgctatgtgctgaactgtcgcttgagtgcggtgatttctatgacccactt
gagattaccaaaacagaattgctacgagtacacacttccaagtatttaaagtccctcaaa
tggagtgccaacgtagcttgtatcgcggaggttccggtcttgatgtttttgccaaatttc
acagtacaaagtggatatctgcgtccaatgcgttaccaaacggctggctcaatactggct
ggtaaactagccctggaatatggttgggccattaacttgggcggtggattccatcattgc
tgctcgtacaagggcggtggcttttgtccttatgcagatattactttgctccttgtacgg
ttgtttgagttggagtcatccagagtacagaatgcaatgattgttgacttggatgcacac
caggggaatggccatgagcgggactttaagaatatagaggctgtctacatacttgatatg
tacaatgcgtttgtttatccaaaggatcacgaagccaagctcagcattcgttgcggtgta
gagttaaagcatttgacagaagatgcttactacttaaggcaattgagccgatgtctgatg
caagcactcgccgaatttaagccagatgttgttatttataatgccggcaccgatatcctc
aaaggtgatccgttgggtaatttagccattagcgcggacggcgttattgaacgcgatcgc
ttggtgtttagtacgtttcgagcgctgggtatacctatcgttatgttgcttagcggaggc
tacatgaattcatctaagcatgtaatagcagattcaattgtaaatctgcaacgaaaggga
tggttaagtttgcattcttaa

DBGET integrated database retrieval system