KEGG   Drosophila virilis: Dvir_GJ23620Help
Entry
Dvir_GJ23620      CDS       T01066                                 

Definition
(RefSeq) GJ23620 gene product from transcript GJ23620-RC
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dvi  Drosophila virilis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dvir_GJ23620
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ23620
   04070 Phosphatidylinositol signaling system
    Dvir_GJ23620
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dvir_GJ23620
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dvir_GJ23620
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dvir_GJ23620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1266 aa AA seqDB search
MMSAGGTYISTASVEVPQALQDGEKFIKWDDDSGSGTPVTMRVDAKGFFLYWVDQNNELD
ILDIATIRDVRTGQYAKKPKDAKLRQIVTMGPQDTLEEKTVTICHGSDFVNMTFVNFCCT
RRDIAQIWTDGLIKLAYSLSQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSISVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRK
CMSIAQLVEFLNKTQRDPRLNEILYPYANNARAKELIQQYEPNKFNAQKGQLSLDGFLRY
LMSDDNPIMAPNKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCR
CVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEFPVILSFENHCNPRQQ
AKIANYCREIFGDMLLDKPLDSHPLEPNMDLPPPSMLRRKIIIKNKKKHHHHHHHHHKKP
SSSMGQGTPGGSNKLTTANSVDAAAKAATAAAAAANAQQVAAAAQEDGGGVGGGAAAGRT
MTGAANGDIVSGAGGGHAPPLQQIRQSSKDSTGSSDSDSSSDDESLPNTTPSLPSGNEPP
PEKAQKETEAGAEISALVNYVQPIHFSSFENAEKKNRCYEMSSFDEKQATTLLKERPIEF
VNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARS
GYLLKPEFMRRSDRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRVNTFVEVDMYGLPA
DTVRKKFRTKTVRDNGMNPVYDEEPFVFKKVVLPELASIRIAAYEEGGKLIGHRVLPVIG
LCPGYRHVNLRSEVGQPIALASLFLCVVVKDYVPDDLSNFAEALANPIKYQSELEKRDIQ
LSVLTDETDALANADEDLSKSCGQKKELRPVESLATSPKHRASISIIAATSVELPTDRTD
GGRNDDSVSIVASGIQHQHSLEQSVSTSIRQVESSQFDVDLVLAEPLDKILEHKSVREKR
LEMEKKLESLRKKHDKEKLKIAGQKLSPLDGGKKPKFTITNKLVKRLSNRSLEPGVEVPA
CPLDLGDSSEESAGAGELGDEAASSSLEGTQESRLRYACREYTTQYRELQEKYHEAIYSA
AEKVLKNSQTSQMKQLKASLDKVTGEVMHQLQEARRNEVKNLATVHRDRDELVRMKREVA
SSVVERGVAERVRLKQTFEKRTDELQKQHDAVRNALADHRSKVGDDPVLTLADKPGSGNI
PKLKNS
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgcaggcggcacctacatatcgacggccagcgtggaggtgccacaggctctg
caggatggcgagaagttcatcaaatgggacgatgattcgggcagtggtacgccggtgacg
atgcgtgtggatgccaaaggattttttctatattgggtcgatcaaaacaatgagctcgac
atactggatattgccacaatacgcgatgtgcgcaccggacagtatgccaaaaagccaaag
gacgccaagctgcgccagattgtgacgatgggaccgcaggacacgctcgaagagaagacc
gtcaccatttgccatggctctgattttgtcaacatgacatttgtcaacttttgctgcaca
cgacgagatattgcccagatctggacggatggcctcatcaagctggcctatagtctgtcg
cagctgaacggctcggcgattatgttcctgcagaaggcgcacacaaagctctgtctgcag
gtggacaaaagcggacgcatcccagtgaaaaacatcattaaactttttgcgcaaaataaa
gaggatcggaaacgtgtcgagaaggcgctggacgtgaccggcttgccatcgggaaaggtc
gatagcatatcggtgtcgaaatttcaatttgaggacttttataatttgtacaaatatctg
acgcagcgttccgaggtggaacgtctcttcgacagcatcgtgggtaactcaaagcgcaaa
tgcatgtccatagcacagctggtggagtttctcaacaagacgcaacgcgatccacgcctc
aacgagatactctatccgtatgcgaacaatgcacgcgccaaggagctcatacagcaatac
gagcccaacaagttcaacgcacaaaagggccagcttagtttggatggctttttgaggtat
ctaatgagcgatgataatccaataatggcgcccaacaagcttgatctctgcgatgatatg
gaccagccgatgtcgcactatttcatcaactcctcgcacaacacctacctgacgggccat
cagctgacgggcaaatcgtccgtggagatatacaggcaatgtctgctagctggctgcaga
tgcgtcgagctggacttttggaacggacgcaccgaggagccggtcattgtgcacggctac
acatttgtgcccgaaatttttgccaaggacgtgctggaggccatcgcggaaagcgcattt
aaaacatccgaattccctgtgatactgagcttcgagaatcactgcaatcccaggcaacag
gccaagattgccaactattgccgcgaaatctttggcgatatgctgctggataagccgctc
gattcgcatccgctggagcccaatatggatttgccgccgccatcgatgctgcgtcgcaag
atcattatcaagaacaaaaagaagcatcatcatcatcatcaccatcatcacaagaagccg
agctcgtcaatgggccagggcacacctggtggcagcaataaactaacaacggccaactca
gttgacgcagcggccaaggcggcaacggcagcggcagcagctgccaatgcgcaacaagtg
gctgccgcagcgcaggaagacggaggaggagtaggcggaggagcagcagcaggacgcaca
atgacaggcgccgcaaatggcgacattgtaagcggggctggcggaggacatgcgccgcca
ttgcaacaaatacgtcagagctcgaaggatagcaccggctcctcggactcggacagctcc
agcgacgatgaatccctgcccaatacaacgcccagtctgcccagcggcaatgagccgccg
ccggagaaggcccaaaaggaaacggaggcgggcgccgagatttcagcgctggtcaactac
gtgcagcccatacacttcagctcctttgagaatgcggagaagaagaatcgctgctatgag
atgtcctcgtttgatgagaagcaggcgacaactctgctcaaggagcgacccattgagttt
gtcaactacaacaagcatcagctgtcccgggtttatccggcgggcacacgcttcgatagc
tccaattttatgccgcaactgttctggaatgcgggctgccagctggtggcgctgaacttt
cagaccctggacctggccatgcagctgaatctgggcatcttcgagtacaacgcacgctcg
ggctatctgctgaagccggaattcatgcgacgctcggatcggcgactcgatccgttcgcc
gaaagcaccgtggacggcatcattgctggcaccgtttccataaccgtactctcgggccag
ttcctgaccgacaagcgggtcaacacctttgtcgaggtggacatgtacggcctgccggcg
gacacggtacgcaagaagttccgcaccaagacggtgcgcgacaacggcatgaatcctgtc
tacgacgaagaaccgttcgtgttcaagaaggtggtgctgccggagctggccagcatacgc
attgcggcctacgaggagggcggcaagctaattggccatcgggtgctgcccgtgatcggg
ctctgtccgggctatcggcatgtcaatctgcgctccgaagtgggccagcccattgcgctg
gcctcgctctttctgtgcgttgtcgtcaaggactatgtgcccgacgatctctccaatttc
gccgaggctttggccaatcccatcaaataccagagcgagctcgagaagcgcgatatacag
ctctctgtgctgaccgatgagacggacgctctggccaatgccgacgaggatctgtccaag
tcatgtggccaaaagaaggagctgcgcccggtggaatcgctagccacctcgccgaagcat
cgggcgagcatttcgataattgccgccaccagcgtggagctgccaacggatcgcaccgat
ggcggacgcaacgatgacagcgtctccattgtggcgtcgggcatacagcatcagcattcg
ctggaacagtcggtgagcacgtcgattaggcaggtggagtcgtcgcagttcgatgtggac
ctggtgttggccgagccgctggacaagatactagagcacaagtcggtgcgcgagaagcgg
ctcgaaatggagaagaagctcgagtcgctgcgcaagaagcacgacaaggagaagctcaag
atcgctggccagaagctcagccccctcgatggcggcaagaaaccgaagttcaccataacc
aacaagctggtgaagcggctgagcaacaggagcctcgagccgggcgtcgaggtgcccgcc
tgccccctcgacctgggcgacagcagcgaggagagcgccggcgctggcgaactgggcgac
gaggccgcctccagcagcctggagggcacacaggagtcgcgtctgcgctacgcctgccgc
gagtacaccacacagtatcgggaactgcaggagaagtaccacgaggccatctactcggcc
gccgagaaggtgctcaagaactcgcagaccagtcaaatgaaacagctgaaggcctccctg
gacaaggtcaccggcgaggtgatgcatcagctgcaggaggcgcggcgcaacgaggtcaag
aatctcgccacggtgcacagagatcgcgacgagctggtcagaatgaaacgcgaggtggcc
agctccgtcgtggagcgcggcgtggcggaacgcgtgcgcctcaagcagaccttcgagaaa
cgcacggatgaactgcagaagcagcacgatgccgtgcgcaatgcgctcgccgaccatcgc
tccaaggtgggtgacgatcccgtgttaacccttgcagataaaccaggctcaggaaacatc
ccgaagctgaagaattcttga

DBGET integrated database retrieval system