KEGG   Drosophila virilis: Dvir_GJ23887Help
Entry
Dvir_GJ23887      CDS       T01066                                 

Definition
(RefSeq) GJ23887 gene product from transcript GJ23887-RA (EC:2.3.1.48)
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ23887
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dvir_GJ23887
   HAT complexes
    HATB complex
     Dvir_GJ23887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 456 aa AA seqDB search
MTTGKRTRLRRKKSKKSKSRKRTCRKRLLFQRYNYNHILRANSRGSRKTSTKMAQIQEYQ
DLVLDALDTVEFKLIRDKADINNDAIIFHPAMAHQIFGESETIFGYQGLHVRVLYTAGPL
HIYLGIEYEKRVNEISGGEIKADDVVATIAQSLPDGCYFINLDEFLKTLDKADKFQPFGE
KLSEYTRTADDGSERLFEIYQCDYKMSSFLKFFARLQTFILWFVDAASYIDTDDAQWCYF
ICYEKYKNKDGQYQYATAGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLATQLVETIY
KFYQSQKNVVDITVEDPSEDFQRLRNFVDARLCLELKSFARDEIKKGFNKEMVREAREAL
KLNPRQVRKIYELLRLYYTNVHDEKEYKVYRLEVKKRLNAVYYKQIKDLQKMERYKMDTE
MLRARLPNTKQRMEQLQEEYVLIEQDYKNTIDKLRA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacaactggtaaaagaacacggctgcgacgaaaaaagagcaaaaaaagcaaatcgcgc
aaacgtacgtgtcgcaagcgtttgctgtttcaacgctacaactacaatcacattttgcgc
gccaattcgaggggcagccgaaagacaagcaccaaaatggcacaaatacaggaatatcag
gatctggtgctagacgcactcgatacggtcgagttcaagctgatacgcgacaaggcggac
atcaacaatgatgccattatatttcatcccgccatggcgcaccaaatatttggtgagtcg
gagaccatatttgggtatcagggcttacacgtgcgcgtcctgtacacggccggtccgctg
cacatctatctgggcattgagtacgagaagcgtgtcaatgaaatctctggtggtgaaatt
aaagccgatgatgtggtggccaccattgcgcaaagcctgccagacggctgctatttcatt
aacctagatgaatttctcaaaacgctggacaaggctgacaagttccagccatttggcgag
aagctcagcgagtacactcggactgctgatgatggcagtgagcggctctttgagatatat
cagtgcgactataagatgtcatcatttttaaagttctttgcgcgtctgcaaacgtttata
ttgtggtttgtcgacgctgcctcctatatagacaccgacgacgcccagtggtgttacttc
atctgctatgagaaatacaagaataaggatggacagtaccagtatgcaactgctggctac
acaaccgtttatgaatattacgcctatccgcaaaacaagcggccgcgcatcagccaaatg
ctaattttgccaccattccagaaactgggtctggccacccaactagtggaaacaatctac
aagttctaccagagccagaaaaatgtggtagacataaccgttgaggatccatcagaggac
tttcagagattgcgaaattttgtggatgcacgtttgtgtttggagcttaaaagctttgca
cgcgacgaaatcaaaaagggtttcaataaggaaatggtacgggaggcacgtgaggcattg
aagcttaacccgcgtcaggtgcgaaaaatttatgaattgctgcggctctactacaccaac
gtgcatgacgaaaaggagtataaagtgtaccgtctagaagttaagaagcgcctcaacgcc
gtttactataaacagataaaagatctacaaaagatggaacgctataaaatggacacagaa
atgctgcgcgcacgtttgcccaatacgaaacagcgcatggaacagctgcaggaggagtat
gtgctcattgaacaggattacaagaatactattgataagctacgggcctag

DBGET integrated database retrieval system