KEGG   Drosophila virilis: Dvir_GJ24097Help
Entry
Dvir_GJ24097      CDS       T01066                                 

Definition
GJ24097 gene product from transcript GJ24097-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dvi  Drosophila virilis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dvir_GJ24097
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dvir_GJ24097
Transfer RNA biogenesis [BR:dvi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dvir_GJ24097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MATNAPLIMRIMALSINTAKRAGVIIRDVLKQGDLGIVDKGKNDPQTEADRSAQRCIIAS
LTKKFPSIKIIGEEGGSDLNVCDDWLVGEQDEAFLKQICPAAWQDAKPEDFVIWVDPLDG
TAEYTQGYVEHVTVLIGIAIKNSAVGGIIHQPFYKQSSGELGRTIWGLKGLGTGGFTPVK
PPAGEFIITTTRSHSNALHQKAVDVFNASKVLKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEANGGTLTNINGEHYEYHADVEHVNSRGVLASVGNNHKELVEKIPLEVR
QAVGAM
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaacgctccacttataatgcgtataatggcgctgtccatcaacactgcaaaa
cgagccggcgtcatcatacgcgatgttctgaagcagggcgatttgggcattgtggacaag
ggaaaaaatgatccacaaactgaggcagaccgttctgctcaacggtgcatcattgcgtcg
ctaacgaagaaatttcccagcattaaaattattggcgaagagggcggctccgacttgaat
gtatgcgatgattggctggtcggtgaacaggacgaagcattcctgaagcaaatctgtccg
gcggcatggcaagatgccaagccggaggactttgtcatatgggtcgatcccttagatggt
actgcggagtatacacaaggctatgtggaacatgttactgtgctcattgggatagctatt
aaaaactcggctgtgggtggcattattcatcagcccttttacaagcaatccagcggagag
ctaggccgcacaatttggggtcttaaagggcttggtactggaggattcactcctgtgaaa
ccgccagcgggtgaattcatcatcacaacgacccgttcacattccaatgcgctgcatcaa
aaggcagtggatgtcttcaatgccagcaaagtgcttaaggtgggcggcgctggctttaag
gtgctacaactgcttgagggaaaggcgcatgcttatgtatttgccacgccaggatgcaaa
aaatgggacacttgcgcaccggaggcggtgttggaggcaaatggcggcaccctgactaat
atcaatggcgaacattatgaatatcatgcagatgtggagcacgtgaatagcaggggtgtg
ctcgccagcgtcgggaataatcacaaagagctagtggagaagattcctctagaagtgcgg
caggccgtgggagccatgtaa

DBGET integrated database retrieval system