KEGG   Drosophila virilis: Dvir_GJ24225Help
Entry
Dvir_GJ24225      CDS       T01066                                 

Definition
GJ24225 gene product from transcript GJ24225-RA
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ24225
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ24225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2836 aa AA seqDB search
MTFDTRRQGTGTGQATTNNSSSSTTTTTTTTTTNTTTTTTTTAGITSTAQDAGTGTTAVT
TSSMSSSGGDTNNSNTNSQDGAQVTDALTEAGGNAVESAATVMTPEKLIASFPTAKLRSL
TQKISNPRWVVPVLPEQELEVLLNAAIELAQAGVDHDCEPCVEFYRNGLTTSFAKILTDE
AVNSWKYNIHHCILLSCGKLLNLIAIHMQRDNPYLLDLLAIVFDPDNKFNTFNAVRQPEC
FAASDSIWGVLDSNKMYAKPPPEPKNPRGWLVDLINRFGQLGGFDNLLERFNSGLELLKR
NQNTKGGAVKSIASNESVGVEGAGHDNRLTLALIHSLLRPFGQCYELLTPATIAKYFMPT
WNVVLDLLDSFTDDELKREVKPEGRNDYINGIVKSARSLASRLTGQEEMIRDLEMFRLKM
ILRLLQVSSFNGKMNALNEINKVLSSVAYYSHRSQPLPHCLPEDEMDWLTAERMAQWIKS
SDVLGIVLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNMHDL
LAKLAWDFTPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFW
TLAHSQEVPPEVLDQALGAHVKILDYSCSQERDAQKTIWLDKCVGELKSGDTWVLPALRL
IRDICCLYDTTPNHAPRTQTGTNRLQVIERLQNDYSLVILVTNSLTAYMDKVRAMVNETP
SLDAATILIDGRFPHHAQIAERLEFLKFLLKDGQLWLCADQAKQIWHCLAVNAVFTADRE
ECFRWFGKLMGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFERFFKAVNSKEDKLK
AIHRGYILDNEDLIGKDYLWRVITTGGEEIANKAIDLLKEVSTALGPRLQEHITEFHEMF
IGECCSRLRTHYSNILILGKTMLEDADNQDANNDNSKDTKMRFIEAEKMCRIIKVLQEYI
KECDRSFSGDRIHLPLSRVTRGKNTSLYIRFQTPGRPIDDIEIVTHSNETMAAFKRNLLK
RIKGNSTSNTNIKVDLFYTNGELIEVTDEINPLYQYTIRDKMILTAKLTPVGIGLASSPD
SSSDSSTGSPPRPCPDMQRVESESTLPGVIISQHYQYTEFFLKLYQLGSDLEHGRLRDSA
KVLLHLLPCDRHTMRMLQLMCRVPKSPAGDGPKEEDALTGSGQTASDALNAEDCTPEQMF
LHPAPAQVLYNLSVLHGLLIPALDPLGESALQVQSAWMHSGCAHFVLELLTKNNFLPSAD
MHTKRASFQCVLRLAKLFLYIVGSVLSRVGDEPMICDYDNGARSQVDILKQNFSTMPNNA
QGTLRAISAKLAEILATEMLSASHEGERCRALFSSTLQWSCPDITTIKAVVQLAWASSCG
NLQALGSTNDFEDDAIIPDGQDFSMCKEALEVLTISFILNPSANEALSNDANWPKFITSI
VLKNPLRHVRQVASEQLFLASTYCAGDRRPFVYMVNLLVSALKTLVPQYEATCAEFFSVL
CRTLSYGCIYNWPLQIGEGLLGDEIKWLRKIRENVKLTSETQVHEELLEGHLCLAKELMF
FLMPDSKAQLNELIHELIDDFLFTASREYLHLRKHGSLRLDTVPPPVCRSPHTIAAACDL
LIALCQLCVPNMKLLTNTLIDFVCTDTDPLREWDYLPPVGARPAKGFCGLKNAGATCYMN
SVLQQLYMVPAVRVGILKAHGAATNDNEDFSGDSDLTSGGAGGMGPSFFGPSAIPTLASS
SAAATMGADDGSDVRKNYHVIILKHVQAIFAHLGHSALQFYVPRGLWTHFKLQGEPVNLR
EQQDAVEFFMSLFESLDEGLKALGYTQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFS
VDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVTIKRLCVKKLPPVLAIQLKRFE
YDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTSVETTKYELTGIV
VHSGQASGGHYFSYIVSKNPANGKCQWYKFDDGEVTECKMHEDEEMKVQCFGGDYLGEIY
DNNLKRMQYRRQKRWWNAYMLFYTRCDQNPTHFEPSVEQLSLTESRNVVLPLPKPIERSV
RHQNIRFLHSRSIFSVEFFNFIKKLVSCSIPSTRSDKITPAAEELSLLGVQLASQFLFHT
GFRTKKSLRGPVIEWYDTLSHHIRSSSLVRKWFANHALLSPPSRLGEYILMAPSPEVRTV
FVKLVVFFCHFAINDEPLVGYEGSNLCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYV
GLGTREKQQLLKLNVPVQFMQVAMDDGSGPSIKYQYPEFSKLHQVVSHLVRCSDVSDKCQ
SSNQNARPLPNPYKDASISQEELTPLSSECMDILFNRTGYIKKVIEDTNVGDEGLKLLQY
CSWENPHFSRAVLTELLWQCGFAYCHDMRHHTDLLLNILLIEDSWQHHRIHNALNGVAEE
REGLLETIQRAKTHYQKRAYQIIKCLTQLFHKSPIALQMLNTNPSISRHWSIAVEWLQDE
LERQRGIGCQYNSYSWSPPAQSNDNTNGYMLERSQSAKNTWSMAYELCPEEVSEKATTEE
NNESDLESNDDNKQELQQPAQTQQPQVADTNAGKEQQQPDNKSANYPQLATIPTIGGWPG
PAPNSTPTSTPAPNSGSIDGNGIPNLSRQLFSAYTSMGVVSSSDNAAPTVGGGGGSGSGA
NSETESSAQDTGNTDSNINGLTNSLDYFLKFNISSKQGSRNRVNRGGKLPPAAELLMPPL
QQLQSQQQQQQQKPQQLQQQSHQQKHQLQLQLQPKQQQQLQQQQQQQQQQQQQQQQQQQQ
QQQRGDISNSSTSRLI
NT seq 8511 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgatacgcgccggcaaggcacaggaactggccaagccacgaccaacaacagc
agcagcagcaccaccacaaccaccaccaccactaccacgaacaccacaaccaccaccacc
accaccgctggcataacgagcacagctcaagacgctggcacgggcacaacagcagtcaca
acatcgagcatgtccagcagcggtggcgataccaacaatagcaatacgaacagccaggat
ggggcccaagttacggatgccctaacagaagcaggtggcaatgctgtagagagtgccgct
acagtaatgacgccggaaaagctgatagcgtcatttccaaccgccaagttgcgctcccta
acacaaaagatatccaatccacgctgggttgtgcccgtgctgcccgaacaggagctggaa
gtgctgcttaatgccgccattgaactggcccaagctggtgtggatcatgactgcgagccg
tgtgttgagttttatcgcaatggcttaaccacatcctttgctaaaatacttaccgatgag
gcagtcaattcgtggaagtacaatatacatcactgcattttgttgtcgtgcggcaagctg
ttgaatttaattgcgatacacatgcagcgcgataatccctacctccttgatttgctggcc
attgtttttgatcccgataataagttcaacacgttcaatgcggtacgccagccggagtgc
tttgcggcgtctgattctatttggggtgtgctggacagtaataagatgtatgcgaaaccg
ccgccagagccaaagaatccgcgcggctggctagtcgatctcataaatcgctttgggcag
ttgggcggatttgataatctgctcgagcgtttcaatagcggcctggagttgttgaaacgc
aatcaaaacacaaagggtggagcagtcaagagcatcgcatccaatgagagcgtgggcgtg
gaaggcgccggacacgacaatcgactgacactggcgctcatacacagcctgcttcgacct
tttggccaatgttatgagctgctaacgccagctaccattgccaagtactttatgcccacg
tggaatgtggtgctggatctgcttgatagtttcaccgatgatgagttgaaacgcgaggtt
aaacccgagggccgcaatgactatataaatggcattgtgaagtcggcgcgttccctggcc
agccgtttaaccggtcaggaggaaatgatacgcgatctagagatgtttcgccttaaaatg
atattgcgcctgctgcaggtctccagtttcaatggcaagatgaatgccctaaacgagatc
aacaaggtgctttcctcggtggcatactactcgcatcgctctcagcccctgcctcattgc
ttacccgaggatgaaatggactggctgactgcagagcgcatggcccaatggattaagtca
tccgatgtgcttggcattgtgctcaaggactcattgcatcagccacagtatgtggaaaag
ctggagaagatcatacgcttccttataaaagagcaggcactaacgcttgacgatctcgac
gcagtgtggcgagctcaagcgggcaagcacgaagcgattgttaaaaacatgcatgatctg
ttggccaagctggcttgggactttacgcccgagcagctggatcatctatttgaggcgttt
caggccagcatgacgaccgccaacaagcggcagcgagaacgcttgctagagctaatacgt
cgtctggccgaggacgataaaaatggtgtgatggcacagaaagtgctgaagctcttctgg
acactagcgcacagtcaagaggtgccaccggaagtgctcgatcaggcgcttggcgcgcac
gttaagatactcgactatagctgctcacaggagcgagatgcccaaaagaccatttggctg
gataagtgcgtgggcgagcttaaatctggcgacacgtgggtgttgcccgctttgcgcctg
attcgggatatatgttgcttatatgacacaacacccaaccatgcgccacgcacacagacg
ggcaccaatcggttgcaggtgattgagcgtctgcagaacgattactctcttgtgattctg
gtcaccaatagtctgactgcgtacatggataaggtgcgcgctatggttaacgagacgccc
agcctggatgcggcgactattctgatagacggtcgatttccacatcatgctcagattgcc
gagcgtttggagtttctcaagttcttgctgaaagatggccagctttggctttgcgctgat
caggcgaagcaaatctggcattgtctggctgtgaacgccgtgtttacggctgatcgcgag
gaatgtttccgctggttcggtaaactaatgggcgaggagccggatctggatccaggcatt
aataaggacttctttgagaataacatactgcaactggatccgcatctgctgacagaaagt
ggcatcaaatgctttgagcgcttctttaaagccgtcaattccaaggaggacaaactgaag
gccattcaccgaggctacatacttgacaatgaggatctcatcggcaaggattatttgtgg
cgcgtgataaccaccggtggcgaggagattgccaacaaggctatcgatctattgaaggag
gtttcaacagcactgggtccgcgactgcaggagcacataaccgagttccatgaaatgttc
atcggtgagtgttgttcgcgtctgcgaacacactacagcaacattctaatactgggaaaa
acgatgctggaggatgccgacaatcaggatgcgaataatgataattcaaaggatacaaaa
atgcgcttcattgaggcagagaaaatgtgtcgcatcatcaaggtgcttcaggagtacatt
aaagagtgcgatcgctcctttagcggcgatcgcatccatctgcctctcagtcgcgtcacg
cgcggcaagaatactagtctctacatacgtttccaaacgcccggacggcccattgacgac
attgagattgttacgcacagtaacgagacaatggcagccttcaagcgcaatctgctgaag
cgcatcaagggcaactccacatctaataccaatataaaggtggatctcttctataccaat
ggtgagctaatcgaggtcaccgacgagatcaatccactataccaatacactatacgcgac
aaaatgatattaacggccaagctgacaccggtgggcattggcctggccagcagtcccgac
tcctccagcgactccagcactggttcgccacctaggccctgtccggatatgcagcgcgtc
gagtcggagagcacgttgcccggcgtgattatctcacagcactatcagtacactgagttc
tttttgaagctctatcaactgggcagtgacttggagcacggtcgcctacgtgatagcgcc
aaggttctgctgcatttgttgccctgtgatcgtcacacaatgcgcatgttgcagctcatg
tgccgcgtccctaagtcgcccgccggtgatggtcccaaggaggaggatgctttgactggc
agcggtcaaaccgctagtgatgcgctaaatgccgaggactgcacacctgagcagatgttc
ctgcacccggcacctgcccaagttctgtataatctgagcgttctgcatggattgttgata
cctgcgctggatccgctgggcgagtcagcgctgcaagtgcaatccgcctggatgcattcg
gggtgtgctcatttcgtgcttgagctgctcacaaaaaacaactttttgcctagtgctgat
atgcacacaaagcgtgcctccttccagtgtgtgctgcgtctggccaagctgtttctctac
atagtgggtagcgtattgtcccgcgtgggcgatgaaccaatgatctgtgactatgacaac
ggcgctcgctctcaggtggacatacttaagcagaacttctcgacgatgcccaacaatgcg
cagggcacgctgcgcgccatctcggccaagctggctgagatattggccaccgagatgcta
tcggccagtcatgagggtgaacgctgtcgtgcactctttagctccacgctgcaatggtcc
tgtccagatataaccaccatcaaggcggtggtgcagctagcgtgggcctcgtcgtgcggt
aatcttcaagctttgggcagcaccaacgatttcgaggatgatgccatcatacccgatggc
caagatttcagcatgtgcaaggaggcgctagaggtgttaacgatctcttttatactcaat
cccagcgccaatgaagcgctgagcaatgatgccaattggcccaaatttattacctcaatt
gtgctgaagaatccgttgcgccatgtgcgtcaagtggcatctgagcagctgttcctggcg
tccacctattgcgccggtgatcgtcgcccgtttgtctacatggtcaatctgcttgtgagc
gcactgaaaaccctggtgccccagtacgaggccacttgcgcggaattcttttcggttctc
tgtcgcacgctctcctatggatgcatatacaactggccactgcagattggtgagggtctt
ctgggcgatgagatcaagtggctgcgtaagatacgtgaaaacgtcaaactcaccagtgaa
acacaggtgcacgaggaactgcttgagggccatctttgtttggccaaggagctaatgttc
ttcctgatgcctgactcaaaggcgcagctgaacgagctaatacacgagctcatcgatgac
tttttgttcacggcatcgcgcgagtatctgcatttacgcaagcacggcagcctgcgcctg
gacacggtgccaccaccagtgtgccgcagtccgcacacaattgctgccgcttgtgatctt
cttattgctttgtgccagctctgtgttcctaatatgaagctactcaccaatacactcatc
gatttcgtctgtacggataccgatccgttgcgcgaatgggattatctgccgccggtgggg
gctcggccagctaaaggattctgtggtttgaaaaacgctggagctacctgctacatgaac
tcggtgctgcagcaactgtacatggtgccagctgtgcgtgtgggcatcctcaaggcacat
ggagctgctaccaatgacaacgaggatttcagcggcgactcggatttaactagcggcggc
gctggtggcatgggcccctccttttttggcccctcagcaataccgacgctcgcatcgtca
tcagcagctgccaccatgggagctgatgacggctccgatgtgcgcaagaactatcatgtg
atcatacttaagcatgtgcaggccatattcgctcatttgggccacagtgcgctgcagttc
tatgtgccacgcggtctctggacgcattttaaactgcaaggcgagccggtgaatttgcgc
gagcaacaggatgcagttgagttctttatgtcgctgtttgagagtctcgatgaaggactc
aaagcacttggctacacgcagctgatgaatgcaacgttgggtggctcgtttagtgatcaa
aagatttgccaagagtgcccacatcgctactccaaagaggaaccatttagcgtatttagt
gttgatattaggaatcatagctcattaactgaatctctggagcagtatgtaaaaggagag
ctgctcgagggagctgatgcataccattgtgataaatgtgataaaaaagtagttaccatt
aagcggctatgtgtcaagaagctgccgcccgtgttagccatacaattgaagcgctttgaa
tacgactacgagcgcgtttgcgcgattaagtttaatgattattttgaatttccgcgtatc
ctggatatggagccctacacagtttctggcctagctaagctagaaggcgaagttgtggaa
gtaggtgataattgtcaaacaagtgttgaaacaacaaaatacgaactgaccggcattgtg
gtgcatagcggacaggcatccggtggccactacttcagctacatagtatccaaaaatcct
gcgaacggcaagtgccaatggtacaagttcgatgatggcgaggtaactgaatgcaaaatg
cacgaggatgaggaaatgaaggtgcaatgctttggcggcgactatttgggcgaaatttat
gataacaatctaaagcgcatgcaatatcgacgtcaaaagcgctggtggaatgcgtatatg
cttttctacacgcgttgcgatcaaaatcccacacatttcgaacccagtgtggagcagttg
tcgctaacagagagccgtaatgtggtgctgcccctaccgaagccaattgagcgaagtgtc
agacatcaaaatattcgttttctgcattcgcgcagcattttctcggtcgagttctttaat
tttattaaaaagctggtcagttgcagtattccctcaacgcgcagcgataaaattacacct
gctgctgaggaactttcgctgctgggcgtacagttggcatcacagtttctgttccatact
ggatttcgtactaaaaaatcgctgcgtggtcccgtcatcgaatggtatgacacgctctca
catcacatacgttcctcctcgctggtgcgcaagtggtttgcgaatcatgccctgctctcg
ccaccgtcgcgcctgggcgagtatatattgatggcgccctccccggaggtgcgcaccgtg
ttcgtcaagctggttgtgttcttttgccatttcgccatcaatgatgagccgcttgttggc
tacgagggtagcaatctctgcgagcaggttcttattagtgtgctgcgtctgcttaaatct
gaggctgctgactatggcaagcatttaccgcattacttcagtctgttcagcatgtacgtg
ggcctgggtactcgcgagaagcaacagctactcaagttaaatgtgcccgtgcagtttatg
caggtggccatggacgatggatcagggccgtcgattaagtatcagtatccagaatttagc
aagctgcatcaggtggtgtcgcatttggtgcgctgcagcgatgtcagcgacaagtgccag
agctccaatcaaaatgcgcgacctctgcccaatccgtacaaggacgcaagtatttcccaa
gaggagctgacgccgctgtccagtgaatgcatggatattctcttcaatcgcaccggctat
atcaaaaaggttatcgaggacacgaatgtgggcgatgagggtttgaagctgctacagtat
tgcagctgggaaaatccacatttctcgcgtgcggtgctcacagagctgctgtggcaatgt
ggcttcgcctattgccatgatatgcgccaccacacagatctattgctgaacatattgctg
attgaggattcttggcagcatcatcgcatacacaatgcgctcaacggcgtggcggaggag
cgtgagggcctgttagagacgatacagcgcgccaagacgcactatcagaagcgcgcctat
cagataatcaaatgtctaacacagctgttccacaagtcacccattgcgcttcaaatgctg
aacactaatcctagtataagtcgtcattggagcattgccgttgagtggctgcaggatgag
ctggaacgccagcgtggcataggctgtcagtataactcgtactcatggtcgccgccggca
cagagcaatgacaacaccaatggctacatgctcgagcgctcacaatcggcaaagaacacc
tggtccatggcatacgagctgtgcccggaggaggtgagcgagaaagctacgacggaagag
aacaacgaatctgacttggaatcaaacgatgacaacaagcaggagctacaacagccggcg
cagacgcagcagccacaagtcgcagatacgaatgctggcaaagagcaacagcagccagat
aacaaatcggccaactatccacagctagcaacaatcccaacaattggcggatggcccggc
cctgccccaaactcaacaccgacttctacaccagcaccaaactcgggttccatagatggc
aatggcataccgaatttgtcacgtcaattgtttagcgcctacacatctatgggcgtcgtc
tcctccagtgacaatgctgcgccgactgtcggtggcggtgggggcagcggaagcggtgcc
aacagcgaaaccgagagcagcgctcaggatacgggcaacaccgactccaacataaatggc
cttaccaacagtttggattattttttaaaatttaatatttcatcaaaacagggcagccga
aatcgtgttaaccgaggaggtaaattgccgccggcagcggagctgctaatgccgccactg
caacaactacagtcacaacaacaacaacaacaacagaaaccgcaacagctacaacaacag
tcacatcaacaaaaacatcaactacagctgcaactacaaccaaaacagcaacaacaactg
caacagcagcagcagcagcaacaacaacaacagcagcaacaacaacagcaacaacaacaa
caacaacaacgtggtgatattagcaacagttccacaagccgcttaatttga

DBGET integrated database retrieval system