KEGG   Drosophila virilis: Dvir_GJ24290Help
Entry
Dvir_GJ24290      CDS       T01066                                 

Definition
GJ24290 gene product from transcript GJ24290-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dvi  Drosophila virilis
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dvir_GJ24290
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dvir_GJ24290
   04068 FoxO signaling pathway
    Dvir_GJ24290
   04070 Phosphatidylinositol signaling system
    Dvir_GJ24290
   04150 mTOR signaling pathway
    Dvir_GJ24290
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dvir_GJ24290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1076 aa AA seqDB search
MADMTFSKDKYMCSRFAIDLWKYDPPDVVHLTCLMPNGLMLYLVAKSTATIREVKVEMVT
QAKCGPLGYLIKDACDYLVYGISHYTIEPYTDETKRLFEVQPYFGLLSLGERTDTTTFSS
DYELTKMVTDIIGKSFDHQNTQGTPEVDHFRTKVALICDNIKIERSKYSWQQRLLYEHPL
RLANSTTMPELIRQRHPSSAFLIAVKNENDQSTFTLSVVENDTPLSLIDSTLQKMNRSQM
KMNDRAADYILKVSGRDEYLFGDHPLIQFLYIQEALSDAAVPNVVLQSVLRLESYINHYS
EQSLGLKSPPKPDRQTTATLHKPITMLWDLEEVNFTLTLHGVTNVNFDRARAFKVGVHVG
LYHGKRKLCAQRSVDASSCGSSQDFQFDDNVMEFDIQMRNLPRMTRLCIVVFEVTKMSRS
KKSSNNSSTLKDVFYNNNPLAWVNTTLFDYKNQLRKGRQTLYTWTYADDIQSDDVFYPLG
TVESNPRKDGCAMVHLTFHQGANDSSNEDVCYPSEEEVLQYAEDRANRDKQQPIADPEKT
LLGVLLANYSGKDKIYEMVDQDRNTIWERKNDILREFPEDLPVLLHCVYWKDRDDVADIW
YLLKQWPLISIERSLELLDYAFPDPAVRGFAIKCLHNLKDEDLLLYLLQLVQAIRHESYL
ENDLVIFLLERALRNQRIGHYFFWHLRSEMQTPCMQTRFGLLLEAYLKGCKQHVKPLRKQ
LEVLEKLKQGSVIAKKGSKEKVRNVLQKFLRNEHNNGVFQNIQNPLNPSFRCSRVTPDKC
KVMDSKMRPLWVVFENVDQTANDVYIIFKNGDDLRQDMLTLQMLRVMDQLWKREGLDLRM
NIYNCISMEQRLGMIEVVRHSETIANIQKEKGMFSATSPFKKGSLYSWLKEHNKAPEKLN
KAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKEKFGVRRER
VPFVLTHDFVYVINKGCIDREAKEFCYFQTLCERAFLILRKHGCLILSLFSMMISTGLPE
LSSEKDLNYLRETLVLDYTEENARKHFQAKFSEALANSWKTSLNWASHNFSKNNKQ
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatgacattttcaaaggacaaatacatgtgcagcagattcgcgattgatctc
tggaagtacgatccgccagacgttgtccatctaacatgcctgatgcccaacgggctgatg
ctctatttggtcgccaaatcaacggccaccatacgcgaggttaaagtggaaatggtgaca
caggcgaaatgtggcccattgggctatttgattaaggatgcatgcgattatctggtatat
ggcatctcgcactacaccatcgagccatatacggacgagacgaagcgtctgtttgaggtg
cagccctactttggactgttgagtctgggtgaacgcacggatacgacaaccttttccagc
gactatgagctgaccaaaatggtaactgatatcattggcaagtcgttcgatcatcagaac
actcagggcacaccggaggtggatcactttcgtacaaaagtggcattaatctgcgataac
attaaaatagagcgatcgaaatattcgtggcaacagcgtttactttacgagcatccactg
cgactggcaaactcgacaaccatgccggaacttatacgacagagacatccaagctcagca
tttcttattgccgtcaagaacgagaatgatcagagcacgttcacgttgtctgtggtggag
aacgatactccgctctcattgatcgacagcacactgcagaagatgaatcgttcacagatg
aagatgaacgatcgtgccgccgactatatactcaaggtgagcggccgggatgagtatctg
tttggtgatcatccgctgatacagttcctgtacatacaagaggcgctctccgatgcggcg
gtgccgaatgtggttctgcagtcggtgctgcgtctcgagtcctacatcaatcactacagt
gagcaaagtctgggcctgaagagcccaccaaagccggatcggcaaaccacagcgacactg
cacaagcccattacaatgttgtgggatttggaggaggttaactttacattaacactacac
ggcgtcaccaatgttaactttgatcgtgcacgcgcttttaaagtgggtgtccatgttggg
ctctatcacggcaagcgcaagctgtgtgcccagcgcagcgttgatgcatccagttgtggc
agttcgcaagactttcaatttgatgataatgtgatggaattcgatatacaaatgcgtaac
ctgccacgcatgacgcgtctgtgtatcgtggtgtttgaggtaaccaaaatgtcgcgctcg
aaaaaatcttctaataacagcagcacgctcaaggatgtcttttacaataataatccattg
gcttgggtcaataccacgctctttgactacaagaaccaattgcgcaagggacggcaaacg
ctatacacctggacatatgccgacgacatacaatcggatgatgtcttttatcctctgggc
actgttgagtcgaatccgcgcaaagacggttgcgccatggtgcatctgacattccaccag
ggcgccaacgacagcagcaatgaagatgtctgctacccaagcgaggaagaggtgctacaa
tatgcagaagatcgtgccaaccgcgataagcaacagccaatcgcagaccctgagaaaaca
ctccttggtgtcctgctagccaattattcgggcaaagataaaatctacgaaatggtcgat
caagaccggaataccatatgggagcgcaaaaacgatattttgcgcgaatttccagaagat
ctgcccgtgctgttgcactgcgtctactggaaagaccgtgatgatgtggccgacatttgg
tatctgctcaagcagtggccgcttatctccatcgaacgctcgctggagctgttagattat
gcctttcccgatccagcagtacgcggatttgctatcaagtgtctgcataatctcaaggat
gaggatctgctgttgtacctactgcagctggtgcaggcaattaggcacgagtcgtatttg
gagaacgatctggtaatatttttgctggagcgagccttgcgcaatcagcgcataggacac
tactttttctggcatctgcgatccgaaatgcaaacaccctgtatgcagactcgctttggc
ctgcttctagaagcttatcttaaaggttgcaaacagcatgtgaaaccactgcgaaaacag
ctcgaagtactggaaaagctcaagcagggctccgtgatagctaagaagggcagcaaggag
aaagtgcgcaacgtacttcagaagttcctgcgcaacgagcacaataacggcgtcttccaa
aatatccaaaaccccttaaatccgagcttcagatgcagtcgcgtgacgcccgataaatgc
aaggtgatggacagcaaaatgcgaccactctgggtggttttcgaaaacgtcgatcagacg
gccaacgatgtgtacatcatatttaaaaacggcgatgatcttcgccaggacatgcttaca
ttgcaaatgctccgcgtcatggatcagttgtggaagcgtgaaggattggatttgcgcatg
aacatctacaactgtatcagcatggagcaacgtttgggcatgattgaagtggtgcgtcat
tcggagacaattgcgaatatacaaaaggaaaagggcatgttttcggcaacatcgccattt
aagaagggctcgctctacagctggcttaaggagcacaacaaggcgcccgagaaacttaac
aaagccattaacgagtttacgctcagctgtgctggatactgcgttgcgacatacgtgctg
ggcgtagccgatcgtcattctgacaatatcatggttaagcgcaacggacagctcttccat
attgactttggccacattttgggccactttaaggagaagtttggtgtgcgtcgcgaacgt
gtgccctttgtgcttacacatgactttgtctacgtcattaacaaaggctgtatcgatcgc
gaggcaaaagagttctgttattttcagactttgtgcgagcgtgcatttttaatattacgc
aaacacggctgccttatactatcgctgttctcaatgatgatatcaacgggactgccggaa
ctgtcctccgaaaaggacttaaactatttacgtgagactttggtgctggattacacggag
gaaaatgcgcgcaaacatttccaagcgaaattcagtgaagctctggccaattcgtggaag
acttcactcaattgggcctcgcacaatttctctaaaaacaacaaacagtaa

DBGET integrated database retrieval system