KEGG   Drosophila virilis: Dvir_GJ24424Help
Entry
Dvir_GJ24424      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dvi  Drosophila virilis
Pathway
dvi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dvir_GJ24424
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dvir_GJ24424
DNA repair and recombination proteins [BR:dvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Dvir_GJ24424
 Prokaryotic Type
     Dvir_GJ24424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG DUF4918 Pox_F15 CAAP1
Motif
Other DBs
NCBI-GeneID: 6630495
NCBI-ProteinID: XP_002054389
FlyBase: FBgn0211504
UniProt: B4LXV0
Position
Unknown
AA seq 284 aa AA seqDB search
MLKRKLEKKKAAALDLKKLKTIQPDALTSGLFVQPFWMQFYKIECQLNEQLATLGLPTGI
TCTYNPVEYASSLHCAYLSRYLCGPKRVIFIGMNPGPNGMGQTGVPFGNVRTVRDMMHLS
GEVLQPSVLHRKRPVNGLNCKIEEPSGVRLWELFERLAAGSLDTLSQQCFVHNFCPLAFF
DEEGHNITPSELKGQLKQQIRDMCLDALEKQLQLLQPQFVVAVGEYVHKVLNRSSYCKTV
SVSRLPHPSPRSLHNTNWSEKAQAFLEEQDLIKFMRNEAQGNSY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgaaaactggaaaagaaaaaagcggcagcccttgacctgaagaagttaaaa
acaattcagcctgatgcattaacttcaggactgtttgtccaaccattttggatgcagttt
tataaaattgaatgccaattgaatgagcaactggctacgcttggactgcccacgggcatt
acatgtacttacaatccagtcgagtatgcgtcgtcgttgcattgtgcctatttaagtcgt
tatttatgtggacccaagcgtgtcatatttataggcatgaaccctgggccaaacggcatg
ggccagacaggcgtaccttttggaaacgtacgcaccgtgcgcgacatgatgcatctctct
ggcgaggtgctgcagccgtctgtgctgcatcgtaaacgtcctgtaaatggattaaattgc
aagattgaggagccgagcggtgtgcggttgtgggagctgtttgagcgtttggctgccggc
agtctagataccctttcgcaacaatgctttgtccacaacttttgccccctggcattcttc
gatgaagagggtcacaacataacaccaagcgaactgaaaggccaattaaagcagcagatt
cgagacatgtgcttggatgcattagagaagcagctgcaactgttgcagccgcaatttgtg
gtggcagtaggagagtatgttcacaaggtgctgaacagatcgtcgtattgtaaaacagtt
tctgtgagccgcttaccacatccaagtccgcgctcgcttcacaatactaactggtcagaa
aaggctcaggcttttttggaggagcaggatcttatcaagtttatgcgcaatgaggcgcaa
ggtaattcttattga

DBGET integrated database retrieval system