KEGG   Drosophila virilis: Dvir_GJ24424Help
Entry
Dvir_GJ24424      CDS       T01066                                 

Definition
GJ24424 gene product from transcript GJ24424-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dvi  Drosophila virilis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dvir_GJ24424
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dvir_GJ24424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MLKRKLEKKKAAALDLKKLKTIQPDALTSGLFVQPFWMQFYKIECQLNEQLATLGLPTGI
TCTYNPVEYASSLHCAYLSRYLCGPKRVIFIGMNPGPNGMGQTGVPFGNVRTVRDMMHLS
GEVLQPSVLHRKRPVNGLNCKIEEPSGVRLWELFERLAAGSLDTLSQQCFVHNFCPLAFF
DEEGHNITPSELKGQLKQQIRDMCLDALEKQLQLLQPQFVVAVGEYVHKVLNRSSYCKTV
SVSRLPHPSPRSLHNTNWSEKAQAFLEEQDLIKFMRNEAQGNSY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgaaaactggaaaagaaaaaagcggcagcccttgacctgaagaagttaaaa
acaattcagcctgatgcattaacttcaggactgtttgtccaaccattttggatgcagttt
tataaaattgaatgccaattgaatgagcaactggctacgcttggactgcccacgggcatt
acatgtacttacaatccagtcgagtatgcgtcgtcgttgcattgtgcctatttaagtcgt
tatttatgtggacccaagcgtgtcatatttataggcatgaaccctgggccaaacggcatg
ggccagacaggcgtaccttttggaaacgtacgcaccgtgcgcgacatgatgcatctctct
ggcgaggtgctgcagccgtctgtgctgcatcgtaaacgtcctgtaaatggattaaattgc
aagattgaggagccgagcggtgtgcggttgtgggagctgtttgagcgtttggctgccggc
agtctagataccctttcgcaacaatgctttgtccacaacttttgccccctggcattcttc
gatgaagagggtcacaacataacaccaagcgaactgaaaggccaattaaagcagcagatt
cgagacatgtgcttggatgcattagagaagcagctgcaactgttgcagccgcaatttgtg
gtggcagtaggagagtatgttcacaaggtgctgaacagatcgtcgtattgtaaaacagtt
tctgtgagccgcttaccacatccaagtccgcgctcgcttcacaatactaactggtcagaa
aaggctcaggcttttttggaggagcaggatcttatcaagtttatgcgcaatgaggcgcaa
ggtaattcttattga

DBGET integrated database retrieval system