KEGG   Drosophila virilis: Dvir_GJ24563Help
Entry
Dvir_GJ24563      CDS       T01066                                 

Definition
GJ24563 gene product from transcript GJ24563-RA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MTDRRVSYFYNANVGNFHYGAGHPMKPQRLAVTHSLVMNYGLDKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHHHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTRGHGECVKFVRGLNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQEIANDLPVTEYYDFFAPDFTLHPEVNSRQDNANSKQYL
ELIVKHVYENLKMCQHSPSVQMVQTPPDVDIEELRMKEETDPDVRMSQTDEDKLVEAKNE
FYDGDQDQDKPDSVES
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactgacagacgtgtctcgtacttctacaacgccaatgtgggcaattttcactatggt
gcagggcatccgatgaagccgcagcgcttagccgtcacacacagcctggttatgaactat
ggcttggacaagaagatgaaaatttacaggccgtacaaagcaagtgcacaggatatgctg
cggtttcacagtgatgaatacatcgcctacctgcagcaggtgactccacagaatatacaa
tgcaattccgtcgcttatacgaagtatttggctcactttagcgtgggcgaggattgtccc
gtcttcgatgggctttttgacttttgcgccatgtacacgggcgcttcactggagggcgca
caaaagctgaatcaccatcacagcgacatatgcattaattggtctggcggtctgcatcat
gccaaaaaatttgaggcctccggcttttgctatgtcaacgatattgtaattggaatactg
gagctgctaaagtatcatccgcgtgttctgtatatagacatcgatgtgcatcatggagat
ggagtgcaggaagcattctatttaacggatcgcgtgatgacagcttcgtttcacaaatat
ggcaactacttctttccgggcactggtgatatgtatgagattggtgccgagtctggccgg
tattatagcgttaatgtgcctctcaaggagggtattgacgaccagagctactttcaagtg
ttcaagccgatcatttctgcgattatggatttttatcggcctacagcaattgtgctgcaa
tgtggcgcagactcattggctggagatcgtctaggctgcttctcgctcagtactcgcggt
catggcgagtgcgttaagtttgtcaggggtttaaatgtgcccacattggtagtgggcggt
ggcggatacactttgcgcaacgttgcacgctgctggacacatgaaacttcgcttctagtc
gaccaggaaattgctaacgacttgcccgtaacggagtactatgatttctttgcgccagac
ttcacactacatcctgaggttaactcacgacaagacaatgctaactcaaaacagtacttg
gagctgatcgtgaagcatgtgtatgaaaatctaaaaatgtgccagcactcaccaagcgtg
caaatggtgcaaacgccgccggacgttgatatagaggagctacgcatgaaggaggaaacg
gacccagatgtgcgcatgtcacagacggatgaggataaactggttgaagcaaagaacgag
ttttatgatggtgatcaagatcaggacaaaccggattcagtagaaagttaa

DBGET integrated database retrieval system