KEGG   Drosophila virilis: Dvir_GJ24711Help
Entry
Dvir_GJ24711      CDS       T01066                                 

Definition
GJ24711 gene product from transcript GJ24711-RA
Orthology
K08341  
GABA(A) receptor-associated protein
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Regulation of autophagy
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dvi04068]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:dvi04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 124 aa AA seqDB search
MNVNFQFKKDHSFEKRRAEGDKIRRKYPDRVPVIVEKAPKTRHAALDKKKYLVPNDLTVG
QFYFLIRKRINLRPDDALFFFVNSVIPPTSASMGLLYHEHRDKDFFLYMAYSDENVYGHE
KYET
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaatttccagtttaagaaggatcactcatttgaaaagcgacgagcagaaggg
gacaaaatacgcagaaagtatcctgatcgcgtacctgttatcgtggaaaaggcaccaaag
acacgtcatgcagctctggataaaaagaaatatttggttcctaatgatctgacagttggc
cagttctactttcttatccgtaaacgcataaatcttcggccggatgacgctctgtttttc
ttcgtcaacagtgtcattcctccgacatcggcttcaatgggactattgtaccatgagcac
cgtgataaggactttttcttgtatatggcttactccgatgagaatgtctacggacatgaa
aaatatgagacttag

DBGET integrated database retrieval system