KEGG   Drosophila virilis: Dvir_GJ24711Help
Entry
Dvir_GJ24711      CDS       T01066                                 

Definition
(RefSeq) GJ24711 gene product from transcript GJ24711-RA
  KO
K08341  
GABA(A) receptor-associated protein
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dvir_GJ24711
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dvir_GJ24711
Ubiquitin system [BR:dvi04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   Dvir_GJ24711
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dvir_GJ24711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 125 aa AA seqDB search
MMNVNFQFKKDHSFEKRRAEGDKIRRKYPDRVPVIVEKAPKTRHAALDKKKYLVPNDLTV
GQFYFLIRKRINLRPDDALFFFVNSVIPPTSASMGLLYHEHRDKDFFLYMAYSDENVYGH
EKYET
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgtgaatttccagtttaagaaggatcactcatttgaaaagcgacgagcagaa
ggggacaaaatacgcagaaagtatcctgatcgcgtacctgttatcgtggaaaaggcacca
aagacacgtcatgcagctctggataaaaagaaatatttggttcctaatgatctgacagtt
ggccagttctactttcttatccgtaaacgcataaatcttcggccggatgacgctctgttt
ttcttcgtcaacagtgtcattcctccgacatcggcttcaatgggactattgtaccatgag
caccgtgataaggactttttcttgtatatggcttactccgatgagaatgtctacggacat
gaaaaatatgagacttag

DBGET integrated database retrieval system