KEGG   Drosophila virilis: Dvir_GJ24711Help
Entry
Dvir_GJ24711      CDS       T01066                                 

Definition
GJ24711 gene product from transcript GJ24711-RA
Orthology
K08341  
GABA(A) receptor-associated protein
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dvir_GJ24711
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dvir_GJ24711
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dvir_GJ24711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 124 aa AA seqDB search
MNVNFQFKKDHSFEKRRAEGDKIRRKYPDRVPVIVEKAPKTRHAALDKKKYLVPNDLTVG
QFYFLIRKRINLRPDDALFFFVNSVIPPTSASMGLLYHEHRDKDFFLYMAYSDENVYGHE
KYET
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaatttccagtttaagaaggatcactcatttgaaaagcgacgagcagaaggg
gacaaaatacgcagaaagtatcctgatcgcgtacctgttatcgtggaaaaggcaccaaag
acacgtcatgcagctctggataaaaagaaatatttggttcctaatgatctgacagttggc
cagttctactttcttatccgtaaacgcataaatcttcggccggatgacgctctgtttttc
ttcgtcaacagtgtcattcctccgacatcggcttcaatgggactattgtaccatgagcac
cgtgataaggactttttcttgtatatggcttactccgatgagaatgtctacggacatgaa
aaatatgagacttag

DBGET integrated database retrieval system