KEGG   Desulfovibrio vulgaris DP4: Dvul_0177Help
Entry
Dvul_0177         CDS       T00452                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dvul_0177
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dvul_0177
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dvul_0177
Enzymes [BR:dvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dvul_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(215539..216987)
Genome map
AA seq 482 aa AA seqDB search
MPSCDFPGWRSRMEYVCLGCGARHSIDELLYTCPSCGGVFLLEDLDFDHLADHRSGDDWR
TLFDTRASTRCRSLRGIFRFYELMAPVLEEDDIIYLGEGNTPVVDASPALERSVGQRFAY
KNDGQNPSASFKDRGMACAFSYLRALVRKHGWDEVLTICASTGDTSAAAALYASYVGSPI
KSAVILPHGKVTPQQLSQPLGSGATVLEIPGVFDDCMKVVEHLAENYRVALLNSKNSWRI
LGQESYAFEVAQWYGWDMAGKCVFVPIGNAGNITAVMSGFLKMHRLGIIDALPRVFGVQS
HHADPVYRYYSVEDPAQRHYEPVTVQPSVAQAAMIGNPVSFPRVRHLAERFEALGGPGAF
QVVQVTEQAIMDSMIRANRHGHIACTQGGECLAGLLRAKELGLVDKDETAVLDATAHSLK
FSGFQDMYFTNGFPPAYGVTPDATLGNAPSLVLHDEDKVALAEKYTVEAAQRIAAKLGLA
GK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctgtgattttcccggctggcgcagccggatggaatatgtctgcctcggatgc
ggggcacggcactccatagacgaactgctctacacctgcccctcgtgcggcggggtcttc
ctgcttgaagacctcgacttcgaccacctcgccgaccaccgtagcggcgacgactggcgc
acgctcttcgacacccgggcatccacccggtgccgttcgctgcgcggcatcttccgcttc
tatgaattgatggcccccgtccttgaagaggacgacatcatctatcttggcgaaggcaac
acgccggtggtggatgcctcgcccgccctcgaaagaagcgtcgggcagcgtttcgcctac
aagaacgacggccagaaccccagtgcatcgttcaaggacaggggcatggcctgcgccttc
agctaccttcgcgcactggtacgcaagcacggctgggacgaggtgctcaccatctgcgcc
tccacgggtgacacgtccgccgcagcggccctgtacgcctcgtatgtgggttcccccatc
aagtcggcggtcatcctgccccacggcaaggtcaccccgcagcagctttcgcagcctctt
ggcagcggggccacggtgctcgagattcccggcgtgttcgacgactgcatgaaagtggtc
gagcaccttgccgagaactaccgcgtcgccctgctcaactccaagaacagctggcgcatc
ctcgggcaggagtcgtacgccttcgaagtggcccagtggtacggctgggacatggcgggc
aagtgcgtcttcgtgcccatcggcaacgcaggcaacatcaccgctgtcatgtcgggcttt
ctcaagatgcaccgtcttggcatcatcgacgcccttccgcgcgtcttcggggtgcagtcg
caccacgccgacccggtctaccgctactacagcgtcgaagaccccgcgcaacgtcactac
gaacccgtcaccgtccagcccagcgtggcgcaggcggcaatgatcggaaaccccgtgtcc
ttcccccgcgtgaggcacctcgccgaacggttcgaggccctcggcggccccggtgccttc
caggtggtgcaggtgacggaacaggccatcatggattccatgatccgcgccaaccgccat
gggcacatcgcctgcacgcagggtggcgagtgccttgcgggacttctgcgcgccaaggaa
ctgggtcttgtcgacaaggacgagacggcggtgctcgacgccacggcacacagcctcaag
ttctcgggctttcaggacatgtacttcaccaatggttttccgcccgcctatggcgtcacg
cccgacgccactctcggcaacgcgccctcgctggtgctgcacgatgaggacaaggtggca
ctggctgaaaagtacaccgtcgaagcggcccagcgcatcgcggcgaagcttggactggcc
ggcaagtag

DBGET integrated database retrieval system