KEGG   Desulfovibrio vulgaris DP4: Dvul_0187Help
Entry
Dvul_0187         CDS       T00452                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dvul_0187
DNA repair and recombination proteins [BR:dvl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dvul_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(228865..229470)
Genome map
AA seq 201 aa AA seqDB search
MQRLPEPLKALVDQLAKLPGLGPKSALRLAMTLLKWPASETRRLGRGIHDLRDNLHLCRR
CGALTDCDPCALCTDATRTQDMLCLVSEWDSMLTLEEGGFYRGQYLILGGLLAPLDNVNA
DSLELERLTRRLAEGQVREVVLALGTTVEAENTATFIRAMVERQYPGVRVTRLAQGIPLG
AEVKFMDRETLRQSMQYRQEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgtcttcccgaacccctcaaggccctcgtggaccagttggcgaaattgccgggg
ctgggtcccaaatcggccctgcgccttgccatgacgctgctcaaatggccagccagcgag
acacgccgtctcgggcggggcattcacgacctgcgcgacaacctgcatctgtgcagacgc
tgtggtgcgctcaccgattgcgacccctgcgccctgtgtaccgatgccacccgcacgcag
gacatgctgtgcctcgtctcagagtgggacagcatgctcacgctggaagagggtggcttc
tacaggggccagtacctcatcctcggcggcctgctggcaccgctggacaatgtgaatgcc
gattcgcttgaactggaaaggctcacccgccgcctcgccgaagggcaggtgcgtgaagtg
gtgctggcactgggaaccaccgtggaggccgagaacacagccaccttcatccgcgccatg
gtcgaacgccagtaccccggtgttcgcgtgacccgactcgcacagggcatccccctcggg
gccgaggtcaagttcatggaccgtgagaccttgcgccagtccatgcagtaccggcaggaa
ctatag

DBGET integrated database retrieval system