KEGG   Desulfovibrio vulgaris DP4: Dvul_0237Help
Entry
Dvul_0237         CDS       T00452                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dvul_0237
Enzymes [BR:dvl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dvul_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
291782..293293
Genome map
AA seq 503 aa AA seqDB search
MSVRASGILLHFSSLPSVGGIGDIGPVAHAFVRLLASAGQSCWQFLPLNPTSTFIGNSPY
SSPSAFACNPLFISLERLADEGLVSWADIGDLPGAGSEGGALSRVDYEAVDSHRRRVLRA
AYERNRGALAVDGGFRDFCRAEAHWLDDYAAFVSIKSAHSGASWDEWPEKLCRRDPAALG
HWAASESAEMDYVRFEQYLFHRQWRELRAVAANAGVRLIGDVPIYVTYDSADVWAAPHFF
KLGEDLRPVTVAGVPPDYFSETGQRWGNPVYDWDALRADGYRWWVRRLRRNLALADMVRI
DHFRGFAGFWEIPAEEATAINGRWVDAPGMELFTVLSRALPGLPFIAEDLGVITPDVREL
RDTFALPGMKVLQFAFGGDPASNPDIPFRHVERSVVYTGTHDNPPTRAWFDALPDGDRWR
FETYVGHEVGSDRAATVMQRLALGSVAGLCLLPLQDVLGLGGEARMNMPSIPQGNWSWRM
LPEHMELRRYEALARMTALYGRC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcgcaagtggcatcctgctgcatttctcctcgttaccatccgtcgggggc
atcggcgacatcggccctgtggcccatgccttcgtgcgcctcttggcgtcggcgggccag
tcgtgctggcaattcctccccctcaatccgacatcgacgttcataggcaactcaccctat
tcgagtccctcggcctttgcgtgcaatccgctgttcatcagccttgaacgtctcgccgac
gaagggctggtctcatgggccgatatcggcgacctgccgggggcggggagcgaaggcggc
gcactttcgcgtgtcgactatgaggctgtggacagccaccggcgccgggtcttgcgcgcc
gcctacgaacgcaaccgtggtgcccttgccgttgatggcggtttccgtgacttctgccgc
gccgaggcccactggcttgacgactatgcggccttcgtatccatcaagtccgcccattcc
ggcgcaagctgggacgagtggcccgagaagctgtgcaggcgcgaccctgcggcactgggg
cactgggccgccagcgagtcggcggagatggactatgtgcgcttcgagcaatatctcttc
catcgccagtggcgtgaacttcgcgctgtcgccgccaatgcgggggtgcgcctcatcggt
gacgtgcccatctatgtcacctatgacagtgccgacgtgtgggctgcgccgcacttcttc
aagctgggtgaagacctgcgaccagtcaccgtggcgggggtgccgcccgactatttcagc
gagaccgggcagcgctggggaaacccggtgtacgactgggatgcgttgagggccgacgga
taccgctggtgggtgcgccggctgcgccgcaaccttgccttggcagacatggtgcgcatc
gaccattttcgaggcttcgcgggcttctgggagattcctgcggaggaggcgacagccatc
aatggtcgctgggtcgacgcaccgggcatggaactgttcacggtgctgtctcgggcgtta
ccgggcttgccgttcattgcggaggacctcggcgtcatcaccccggacgtgcgcgaattg
cgcgacaccttcgccctgccgggcatgaaggtgctgcaattcgccttcggcggcgacccg
gcatccaaccctgacatccccttccggcatgtggaacgttcggtggtctatacggggacg
cacgacaacccgcccacgcgggcgtggttcgacgccttgccggacggcgaccggtggcgt
ttcgagacctatgtcgggcacgaggtgggctctgaccgggcggcgacggtcatgcagcgt
ctggcgctgggcagcgtggcggggctgtgcctcttgccgttgcaggatgtgctcgggctt
gggggtgaggcgcgcatgaacatgccctccatcccgcagggcaactggtcatggcgcatg
ctgccggaacatatggaactgcgccgttacgaggcgctggcgaggatgacggccctgtac
ggacgttgctga

DBGET integrated database retrieval system