KEGG   Desulfovibrio vulgaris DP4: Dvul_0252Help
Entry
Dvul_0252         CDS       T00452                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dvul_0252
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dvul_0252
Exosome [BR:dvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvul_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(309795..311288)
Genome map
AA seq 497 aa AA seqDB search
MSNYVLALDQGTTSSRAILFTREGDIKQISQKEFTQIYPQPGWVEHNANEIFDTQSWVMR
ECLQEAGIGAADVVAAGITNQRETTVVWDKATGAPVYNAIVWQDRRTAGFCDELKARGLA
DVFRKKTGLVLDAYFSGTKVRWILDNVPGARAKAEKGELLFGTIDTWLIWNLTKGKAHVT
DSSNASRTLMFNINTGAWDDELLGILDVPRSMLPRVTGSSEVVGDIHPEFLGKAIPIAGN
AGDQQAATYGNACLKPGMAKNTYGTGCFMLMNTGTEVRSSQNNLLSTVAWTTPSGRFYAL
EGSVFIAGAVVQWLRDGLGIIKAAPEVEQLALSVPDNGGVYLVPAFAGLGAPHWDQYARG
TMVGITRGATKAHIARAALESIALQTLDIMDCMQKDSGIKLAALRADGGATRNNLLMQFQ
ADVLGVPVERPKVTETTALGAAYLAGLATGFWKSEDEIATMWQLDRRFEPNMSDDKRQHL
VYEWQRAVERAKAWVEA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactacgtcctcgccctcgaccagggcaccaccagttcccgcgccatcctcttc
acgcgcgaaggtgacatcaagcagatttcgcagaaggaattcacccagatttacccccag
ccgggctgggtggagcacaacgccaacgagatattcgacacccagtcgtgggtcatgcgc
gagtgcctgcaagaggccggcatcggtgccgcggacgtcgtggccgcgggcatcaccaac
cagcgtgagacgaccgtggtgtgggacaaggccaccggcgcccccgtctacaacgccatc
gtgtggcaagaccgccgcaccgcaggcttctgcgacgaactcaaggcccgcggcctcgcc
gacgtgttccgcaagaagaccggcctcgtgctcgatgcgtacttctccggcaccaaggtg
cgctggatactcgacaacgtgccgggagcccgcgccaaggccgaaaagggcgaattgctg
ttcggcaccatcgacacatggctcatctggaacctcaccaagggcaaggcgcacgtcacc
gactcgtccaacgccagccgtaccctcatgttcaacatcaacacgggcgcgtgggatgac
gagcttctgggcatcctcgacgttccgcgcagcatgctgccccgcgtgaccggttcgtcc
gaggtcgtgggtgacatccacccagaattcctcggcaaggccattcccatcgccggcaat
gcgggcgaccagcaggccgccacctacggcaacgcctgcctcaagcccggcatggccaag
aacacctacggcaccggctgcttcatgctcatgaacaccggcaccgaagtccgttccagc
cagaacaacctgctgagcaccgtggcatggacgaccccctcgggacgtttctacgccctg
gaaggcagcgtgttcatcgcaggcgcagtggtacagtggctgcgtgacggtctcggcatc
atcaaggccgcccccgaagtggaacaactagccctgagcgtccccgacaacggcggcgtc
tacctcgtgcccgccttcgcgggactgggtgccccccactgggaccagtacgcccgtggc
accatggtcggcatcacccgcggcgcgacgaaggcccacatcgcacgtgccgcgctcgag
tccatcgccttgcagaccctcgacatcatggactgcatgcagaaggactcgggcatcaag
ctggccgcactgcgcgctgacggcggcgccacccgcaacaacctgctgatgcagttccag
gccgacgttctcggcgtgcccgtcgagcgtcccaaggtcactgagaccacggccctcggc
gcagcctacctcgcgggtctcgccaccggattctggaagagcgaagacgagatagccacc
atgtggcaactcgaccgccgcttcgagcccaacatgtccgacgacaagcgccagcacctc
gtctacgaatggcagcgtgccgtagaacgcgccaaggcgtgggtcgaggcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system