KEGG   Desulfovibrio vulgaris DP4: Dvul_0460Help
Entry
Dvul_0460         CDS       T00452                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dvul_0460
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_0460
  Lipid metabolism
   00071 Fatty acid degradation
    Dvul_0460
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dvul_0460
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dvul_0460
   00626 Naphthalene degradation
    Dvul_0460
Enzymes [BR:dvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dvul_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
584985..586163
Genome map
AA seq 392 aa AA seqDB search
MKDFVYHNPTEVRFGRGVVASLGARVRAAGLSAVVVVAGGGAARRCGAFGDAVASLEAAG
VAWTPCEGVRPNPDLDGVLRAVQALRDAGAGGFVAVGGGSVMDTAKAAGVCALHDGDPWD
HFTRRTTATAAVPVFTVPTLSGTGAEMNGTAVITNMAQQRKWSLRGPTPVAAFLDPVYQR
DVPLALAVGCAVDAMTHVLEFAVAGTPCVDAKALDIPGGTYFMEETVLAQNEALLRSIIR
SVEVLRRIPGDYAARASLAWAAGLGLCGLTGVGLGGGSWVSHALEHAVSGHFPQVPHGPA
LAVLFPCWMEEVASEHTPMFERLARNVWGVEGAVEGIRAMLATFDRWGAPRRLAAWGVGE
DAIPGLVRAALEYPRPLGLAPERVERIFRNAL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttcgtctatcataacccaacggaagtacgtttcggtcggggcgtggtcgcg
tctctcggggcacgtgttcgcgccgcgggactttcggccgttgtcgtcgtcgcggggggc
ggtgctgcccgtcgttgtggtgcattcggcgatgcggtggcctctctggaggcggcgggc
gtagcatggacaccgtgcgagggggtgcgtcccaaccccgacctcgacggcgtattgcgt
gccgtacaggcgttgcgtgatgcgggggccgggggcttcgtcgccgtgggcggcggcagc
gtcatggataccgccaaggctgcgggtgtatgcgccctgcatgacggagacccgtgggac
cacttcacccgtcgcaccacggcgaccgcggcggtgccggtgttcaccgtgcccaccctg
tcagggacgggggcggagatgaacggcacggccgtcatcaccaacatggcgcagcagcgc
aaatggtcgctgcgtggccccacgccggtggcggcgttcctcgacccggtctatcagcgt
gacgtacccctcgcgctggcggtgggctgcgccgtggacgccatgacgcacgtgctggaa
ttcgcggtggcgggaaccccctgcgtggatgcgaaggccctcgatatccccggtgggacg
tatttcatggaagagacggtgctggcgcagaacgaggcgcttctccgttccatcatccgg
tcggtggaggtgttgcgccgcatacctggtgactatgcggcgcgggcgtcgctggcgtgg
gctgcgggccttggcctgtgcgggttgaccggggtggggcttggcggcggttcgtgggtc
tcgcatgccctcgaacatgcggtgagcgggcatttcccgcaggtgccccacggccctgcg
ctggcggtgctcttcccctgctggatggaggaggtcgcatcggagcacactccgatgttc
gagcgcctcgcacggaacgtgtggggcgtggaaggcgctgtggagggcatccgtgccatg
ctcgccaccttcgaccgctggggtgccccgcgccgtctggccgcatggggcgtgggcgag
gacgccatccccggtctcgtccgtgccgcgctggagtacccccgtccgctcggccttgcc
ccggaacgggtggaacgcatcttcaggaatgccctgtag

DBGET integrated database retrieval system