KEGG   Desulfovibrio vulgaris DP4: Dvul_0464Help
Entry
Dvul_0464         CDS       T00452                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00240  Pyrimidine metabolism
dvl00250  Alanine, aspartate and glutamate metabolism
dvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dvul_0464
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dvul_0464
Enzymes [BR:dvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dvul_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABM27487
JGI: Dvul0464
UniProt: A1VAM1
Position
complement(590945..591898)
Genome map
AA seq 317 aa AA seqDB search
MQNETRSLWPHKDLLDVDQLSKDELLHLLDTAAQFHEINRRPVKKVPTLKGKSVILFFAE
PSTRTKTSFDVAGKRLSADTFSLAKSGSSLQKGESLKDTALTLEAMNPDVLVIRHSSSGA
ARFLADRLACGVVNAGDGWHAHPTQALLDCYSLRQVWGDTFEGRTLCILGDIAHSRVARS
NVKLLTSLGVRVRLCAPRTLLPAGVGNWPVEVFTDLDAAVRDADAVMCLRLQLERQQAGL
LPDLREYSNRYCLTPRRLELAKPEARVLHPGPMNRGLEIASSIADAPASLVLDQVAAGVA
TRMAILFLLATRTDGGR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgagacccgtagcctatggccccacaaggacctgctggacgtggaccagctc
tcgaaggacgagcttctccacctcctcgacacggcggcacagttccacgagatcaaccgc
cgtccggtcaagaaggtgcccacactcaagggcaagagcgtcatcctcttcttcgccgaa
cccagcacacgcaccaagacctcgttcgacgtggcgggcaagcgtctgtcggccgacacc
ttctcgctcgccaagagcgggtcgagcctccagaagggcgagagcctgaaggacacggcg
ctcacgctcgaagccatgaaccccgacgtgctggtcatccgccactcgtccagcggggcg
gcgcgctttctcgccgaccggctggcctgcggcgtggtcaacgcgggcgacggctggcac
gcacaccccacacaggcgctgctcgactgctattcgctgcgtcaggtatggggcgacacc
ttcgagggacgcacgctgtgcatcctcggcgacatcgcccatagccgcgtggcacggtcc
aacgtgaagctgctcacctcgctgggtgtgcgcgtgcgactgtgcgccccgcgcaccctt
ctgcccgcgggcgtgggcaactggcccgtggaggtgttcaccgacctcgatgccgccgtg
cgcgacgccgacgcggtcatgtgcctgcgcctgcaactggaacgccagcaggcgggactt
ctgcccgacctgcgcgaatactccaaccgctactgcctcaccccgcgccgcctcgaactg
gcgaagcccgaggccagggtgctgcaccccggccccatgaatcgcggactcgaaatcgcc
tcgtccatcgcagacgcccccgccagcctcgtcctcgaccaggtcgctgccggggtcgcc
acgcgcatggccatcctcttccttctcgcaacccgaacggacggaggccgctga

DBGET integrated database retrieval system