KEGG   Desulfovibrio vulgaris DP4: Dvul_0480Help
Entry
Dvul_0480         CDS       T00452                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00010  Glycolysis / Gluconeogenesis
dvl00071  Fatty acid degradation
dvl00350  Tyrosine metabolism
dvl00625  Chloroalkane and chloroalkene degradation
dvl00626  Naphthalene degradation
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
dvl01130  Biosynthesis of antibiotics
dvl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_0480
  Lipid metabolism
   00071 Fatty acid degradation
    Dvul_0480
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dvul_0480
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dvul_0480
   00626 Naphthalene degradation
    Dvul_0480
Enzymes [BR:dvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dvul_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABM27503
JGI: Dvul0480
UniProt: A0A0H3A5B5
Position
complement(608156..609349)
Genome map
AA seq 397 aa AA seqDB search
MLDFTFHVPTRIVFGAGRLEELGRLPLPGVKPLVVVGAGGSMRRHGHLDRVLALLRQNGC
EPMLFERVRPNPSLVHVDEGACVARANGCDFIVGLGGGSPIDAAKAIALAAANGGSYWDY
IQSGTGGRRTPQHPALPVVAIPTTAGTGTEADPWTVVTRDETQEKIGWGNDSTYPVLSIV
DPALTVTVPPRITAMTGMDAFFHAVEAYLSLSRQPSSDLLALEAVSLLAQFLPQAVRQGD
SVEVRSMVSWASTAAGLCESLSSCIAHHSMEHALSAHHPDLPHGAGLVMLSLPFFEVMAR
VQPKRCADLAATMGMPLHGLPPAQQGMAFVEGLRLLIRAVGLDDLRLADHGITAAEIPAL
AKNARETMGALFPLTPVDLRPEDVEAIFAKALAGPTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacttcaccttccatgtccccacccgtatcgtcttcggtgcaggcaggctcgaa
gaactgggcaggctgccgctgcccggcgtcaagcctctggtggtcgtcggtgcaggtggt
tccatgcggcgtcacgggcacctggacagggtgctcgccctgctgcgccagaacggctgc
gaaccgatgctcttcgagcgcgtcagacccaatccctcgctggtgcacgtggacgaaggg
gcgtgcgtggcgcgcgccaacggctgtgacttcatcgtcggcctcggcggcggcagcccc
atcgacgcggccaaggccatcgccctcgccgcagccaacggtggcagctactgggactac
atccagagtggcacgggtggtcgccgcaccccgcagcaccctgcgctgcccgtcgtcgcc
attccgaccacggcgggcacgggcaccgaagccgacccgtggacggtggtcacccgtgac
gagacacaggagaaaatcggctggggcaacgactcgacctacccggtgctgtccatcgtc
gaccccgcgcttaccgtcaccgtcccgccccgcatcaccgccatgacgggcatggatgcc
ttcttccacgccgtggaagcctatctttccctctcgcgccagccctcaagcgacctgctg
gcactggaggccgtgagcctgctggcgcaattcctgccacaggccgtccgtcagggcgac
agcgtcgaggtgcgttcgatggtctcgtgggccagcaccgccgccggactgtgcgaatcg
ctctcttcctgcatcgcgcaccattcgatggaacacgccctcagcgcccaccaccccgac
ctgccgcacggcgcgggccttgtgatgctctcgctgccgttcttcgaggtcatggcgcgg
gtgcaacccaagcgttgcgccgacctcgccgccaccatggggatgccgttgcatgggctg
cctccggcacagcagggcatggccttcgtcgaagggctacggttgctcatccgcgccgtg
ggcctcgacgacctgcgcctcgccgaccatggcatcaccgccgccgagattcccgcgctg
gcgaagaacgcccgcgagaccatgggggcgctctttcccctgacgccggtggacttgcgc
cccgaagacgtcgaagccatcttcgccaaggccctcgcgggcccgacggcctga

DBGET integrated database retrieval system