KEGG   Desulfovibrio vulgaris DP4: Dvul_0736Help
Entry
Dvul_0736         CDS       T00452                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetases
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dvl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dvl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
900694..902154
Genome map
AA seq 486 aa AA seqDB search
MKPEQVTFDTLLGRVAATLPQIRTDSRRVGPGDVFVAVPGVAVDGAAFITQAVAQGATMV
VCRADGLQHLPEAAFAVAVHDDPRAALGALGQARYGTASLPFPVVGVTGTNGKTTITYLL
EHLFASAGRRCGVLGTVSYRWPGHVETAPLTTPDCLQLHEMLGQMAGAGVDVAFMEVSSH
ALDQERVAGIRFAGAVLTNLTQDHLDYHGDMETYFNAKARLFRELPEVSKHCAVNADDPW
GRRLLADLPGAVGFALTGAPVSGTRHLHGEMLRCSTAGVHLRMHFEGRTWEVDSPLVGAH
NASNLLAVQAVGLGLGLSPADFVHLENFTGVPGRLERITNDRGLDVFVDYAHTPDALVNV
LRALRDVGFTRIVTVFGCGGNRDRTKRPLMGAAVAAHADVAVLTSDNPRHEDPLAIMEDV
KPGLAGAREVVAEADRRKAIALALEMLRPGDALLVAGKGHEDYQQVGDRKLPFSDQQTIR
EILGCN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgaacaagtgacgttcgatacccttctcgggcgcgttgccgcgaccctccca
cagatacggaccgattcgcgcagagtcggtccgggcgacgttttcgtggccgttcccggc
gtcgccgtggacggggccgccttcatcacgcaggcggtggcgcagggggcgaccatggtc
gtgtgccgtgcagacggcctgcaacacctgccggaagccgcctttgccgtggctgtgcat
gacgacccccgcgccgcgctcggtgcgctcgggcaggcgcgttacggcacggcatcgttg
ccctttcccgttgtcggcgtgacaggtacgaacggcaagacgacgataacctacctgctc
gaacatcttttcgcctcggcaggccgccggtgcggcgtgctcggaacggtaagttaccgg
tggcccgggcatgtcgagaccgccccgctgaccactccagactgtctgcaactacacgag
atgcttggccagatggcgggtgcgggtgtggatgtcgccttcatggaagtgtcgtcgcac
gcgcttgatcaggagcgggtcgcgggcatacgtttcgccggggcggtgctcaccaacctc
acgcaagaccacctcgactaccatggcgacatggagacctacttcaacgccaaggcacgc
cttttcagggagttgccggaagtcagcaagcattgtgccgtcaatgccgacgacccctgg
gggcggcgtctgctcgccgacctgccgggtgcagtcggtttcgccctcaccggtgcgccc
gtgtccggaacgaggcacctgcatggtgagatgctgcgctgctcgactgcgggcgttcac
ctgcgcatgcacttcgagggccgcacgtgggaggtcgactctccgctcgtgggcgcacac
aacgcctcgaacctgctggccgttcaggccgtgggtctcgggcttggcctctcgcccgcc
gattttgttcatcttgaaaatttcaccggagttcccggcaggttggagcgtatcaccaac
gaccgggggcttgacgttttcgtcgattacgcccatacgccggacgccctcgtcaacgtg
ctgcgcgcgttgcgcgatgtgggcttcacgcgcatcgtcacggtcttcggctgcggcggc
aaccgcgaccgcaccaaacgccccctcatgggcgctgccgtggccgcacatgccgacgtg
gccgtcctcacgtccgacaacccccgccatgaagacccgctcgccatcatggaagacgtg
aagcccggccttgccggggcgcgtgaggtcgtggcggaggccgacaggcgcaaggccatc
gcccttgcgttggagatgctgcgtcccggagacgcgcttctcgtggcaggcaaggggcat
gaggactatcagcaggtgggcgaccgcaagctgcctttcagcgaccaacagaccatccgg
gagattcttgggtgcaactga

DBGET integrated database retrieval system