KEGG   Desulfovibrio vulgaris DP4: Dvul_0936Help
Entry
Dvul_0936         CDS       T00452                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvul_0936
   00052 Galactose metabolism
    Dvul_0936
   00500 Starch and sucrose metabolism
    Dvul_0936
   00520 Amino sugar and nucleotide sugar metabolism
    Dvul_0936
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dvul_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1149719..1151191)
Genome map
AA seq 490 aa AA seqDB search
MTASTGEQSPFMESSAPMSPRPEHATHSARESFSRLMREERLPGELIDLFLGYHGEIEAS
HTGLIGENDILPAKVEDFTHLDSLTRYAPEGRKLMHRAVCIRLNGGLGTSMGMTHAKSLL
PARHDRSFLDIIHGQAEHQRKAHGGASPLLFMNSYATHADTLRALESMAAPEHMPRCFLQ
HRFPKVDRTTLLPVRSHEADDMAWNPPGHGDIYAALVLSGMLDALLSEGRRWALVANADN
LGASLDPAILGYMAAHRIPFLMECARRTPADSKGGHLARTPEGGLVLREVAQCPADDMAH
FQDIHRYGLFNTNNIWLDLAALRDRVERYGLLRLPLILNPKTLDPRDPESTPVWQVETAM
GAAIALFPGATAIVTPRRRFLPVKRCNDLLLLWSDCFSLGEDFHLNRRVAHDSPLPRIDL
DPKHYGTWDRLMQRFPHGAPAMRSCTAMQVRGDVRFGDDVALDGEVRIRNSAKAQAVIPD
GTRLSGEVHL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccaccggtgaacaaagcccatttatggaatcgagcgcccccatgtcacct
cgccccgaacatgcgacacattccgcgcgcgagtcgttcagtcgcctcatgcgtgaagag
aggctgccgggcgaactcatcgacctcttcctcggctatcatggcgaaatcgaggccagc
cataccggactcatcggtgagaatgacatcctgcccgccaaggtcgaggatttcacccat
ctcgacagcctgacccgctatgcccccgaaggccgcaagctgatgcaccgcgccgtctgc
atcaggctcaatggtggtctcggcaccagcatgggcatgacacacgccaagtcgcttctg
ccagcacgacacgacaggagttttctcgacatcatccacggacaggcagaacatcagcgc
aaggcccacggcggcgcatcgcccctgctgttcatgaacagctacgccacgcacgccgac
accctgcgtgccctcgaaagcatggcggcccccgaacacatgccgcgttgcttcctgcag
catcgtttccccaaggtcgaccgcaccacactccttcccgtacgaagccatgaagccgac
gacatggcgtggaaccctccggggcacggcgacatctacgccgccctcgtactctcgggc
atgctcgacgccctgctttccgaaggtcgccgatgggcgctggttgccaacgccgacaat
ctcggggcatcactcgacccggccattctcggctacatggcggcacatcgcatccccttt
ctcatggaatgcgcccgtcgcacccccgccgacagcaagggcgggcaccttgcccgcacg
ccggaaggcggtctcgtcctgcgcgaggtggcacagtgccctgccgacgacatggcccac
tttcaggacatccatcgctacggactcttcaataccaacaacatatggctcgacctcgcg
gcactgcgtgacagggttgaacgctacggcctgttgcggttgcccctcatcctcaatccc
aagacgctcgacccccgcgaccccgaatccactcccgtctggcaggtggaaacggccatg
ggggcggccatcgccctctttccgggtgcgacagccatcgtcaccccccgccgccgcttt
ctgccggtcaaacgctgcaacgacctgctgctactctggtcggactgcttcagcctcggc
gaggacttccacctcaatcgccgcgtggcgcacgacagccccctgccccgcatcgacctc
gaccccaagcattacggcacatgggacaggctcatgcagcgctttccgcacggcgccccc
gccatgcgcagctgcaccgccatgcaggtgcgcggagacgtccgcttcggcgatgacgta
gccctcgacggagaagtccgcatccgtaacagtgcaaaggcacaggctgtcatccccgac
ggcacgcgtctgtctggcgaagtgcacttgtag

DBGET integrated database retrieval system