KEGG   Desulfovibrio vulgaris DP4: Dvul_0936Help
Entry
Dvul_0936         CDS       T00452                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00040  Pentose and glucuronate interconversions
dvl00052  Galactose metabolism
dvl00500  Starch and sucrose metabolism
dvl00520  Amino sugar and nucleotide sugar metabolism
dvl01100  Metabolic pathways
dvl01130  Biosynthesis of antibiotics
Module
dvl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvul_0936
   00052 Galactose metabolism
    Dvul_0936
   00500 Starch and sucrose metabolism
    Dvul_0936
   00520 Amino sugar and nucleotide sugar metabolism
    Dvul_0936
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dvul_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-ProteinID: ABM27957
JGI: Dvul0936
UniProt: A0A0H3A8Z8
Position
complement(1149719..1151191)
Genome map
AA seq 490 aa AA seqDB search
MTASTGEQSPFMESSAPMSPRPEHATHSARESFSRLMREERLPGELIDLFLGYHGEIEAS
HTGLIGENDILPAKVEDFTHLDSLTRYAPEGRKLMHRAVCIRLNGGLGTSMGMTHAKSLL
PARHDRSFLDIIHGQAEHQRKAHGGASPLLFMNSYATHADTLRALESMAAPEHMPRCFLQ
HRFPKVDRTTLLPVRSHEADDMAWNPPGHGDIYAALVLSGMLDALLSEGRRWALVANADN
LGASLDPAILGYMAAHRIPFLMECARRTPADSKGGHLARTPEGGLVLREVAQCPADDMAH
FQDIHRYGLFNTNNIWLDLAALRDRVERYGLLRLPLILNPKTLDPRDPESTPVWQVETAM
GAAIALFPGATAIVTPRRRFLPVKRCNDLLLLWSDCFSLGEDFHLNRRVAHDSPLPRIDL
DPKHYGTWDRLMQRFPHGAPAMRSCTAMQVRGDVRFGDDVALDGEVRIRNSAKAQAVIPD
GTRLSGEVHL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccaccggtgaacaaagcccatttatggaatcgagcgcccccatgtcacct
cgccccgaacatgcgacacattccgcgcgcgagtcgttcagtcgcctcatgcgtgaagag
aggctgccgggcgaactcatcgacctcttcctcggctatcatggcgaaatcgaggccagc
cataccggactcatcggtgagaatgacatcctgcccgccaaggtcgaggatttcacccat
ctcgacagcctgacccgctatgcccccgaaggccgcaagctgatgcaccgcgccgtctgc
atcaggctcaatggtggtctcggcaccagcatgggcatgacacacgccaagtcgcttctg
ccagcacgacacgacaggagttttctcgacatcatccacggacaggcagaacatcagcgc
aaggcccacggcggcgcatcgcccctgctgttcatgaacagctacgccacgcacgccgac
accctgcgtgccctcgaaagcatggcggcccccgaacacatgccgcgttgcttcctgcag
catcgtttccccaaggtcgaccgcaccacactccttcccgtacgaagccatgaagccgac
gacatggcgtggaaccctccggggcacggcgacatctacgccgccctcgtactctcgggc
atgctcgacgccctgctttccgaaggtcgccgatgggcgctggttgccaacgccgacaat
ctcggggcatcactcgacccggccattctcggctacatggcggcacatcgcatccccttt
ctcatggaatgcgcccgtcgcacccccgccgacagcaagggcgggcaccttgcccgcacg
ccggaaggcggtctcgtcctgcgcgaggtggcacagtgccctgccgacgacatggcccac
tttcaggacatccatcgctacggactcttcaataccaacaacatatggctcgacctcgcg
gcactgcgtgacagggttgaacgctacggcctgttgcggttgcccctcatcctcaatccc
aagacgctcgacccccgcgaccccgaatccactcccgtctggcaggtggaaacggccatg
ggggcggccatcgccctctttccgggtgcgacagccatcgtcaccccccgccgccgcttt
ctgccggtcaaacgctgcaacgacctgctgctactctggtcggactgcttcagcctcggc
gaggacttccacctcaatcgccgcgtggcgcacgacagccccctgccccgcatcgacctc
gaccccaagcattacggcacatgggacaggctcatgcagcgctttccgcacggcgccccc
gccatgcgcagctgcaccgccatgcaggtgcgcggagacgtccgcttcggcgatgacgta
gccctcgacggagaagtccgcatccgtaacagtgcaaaggcacaggctgtcatccccgac
ggcacgcgtctgtctggcgaagtgcacttgtag

DBGET integrated database retrieval system