KEGG   Desulfovibrio vulgaris DP4: Dvul_0988Help
Entry
Dvul_0988         CDS       T00452                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dvul_0988
Enzymes [BR:dvl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dvul_0988
DNA repair and recombination proteins [BR:dvl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dvul_0988
    RecFOR pathway proteins
     Dvul_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 HHH_8 Ribosomal_S13
Motif
Other DBs
NCBI-ProteinID: ABM28009
JGI: Dvul0988
UniProt: A1VC43
Position
1215003..1215611
Genome map
AA seq 202 aa AA seqDB search
MIAYVEGRLAEVAGNACVVVTDGGVGYEVFVPGHTLARLPDKGGRVSFFISTEVREDALE
LYGFATWDERQTFIVLTSISKVGAKTGLAILSQFRPDDLRRLVVEDDVLALTRVSGIGKK
TAQHIFLELKYKLKVEDLPAAAPLVTGGAPGGVFRDALAGLANLGYGEEEASHVLKEVLH
GEPDLDVGGALRAALRALARGR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgtatgtcgaaggccgtctggccgaagtcgcgggcaacgcctgtgtcgtcgtc
accgacggcggggtggggtacgaggtcttcgtgccggggcacacgcttgcgcgtcttccc
gacaagggggggcgggtcagcttcttcatcagcaccgaggtgcgtgaggatgctctcgaa
ctctacggtttcgccacatgggacgagcgtcagacgttcatcgtgctcacgtccatctcc
aaggtcggtgccaagaccgggcttgccatcctctcgcaattcaggccggacgacctgcgg
cgtctcgtggtcgaagacgacgtgctggcgctcacccgtgtctcgggcatcggcaagaag
acggcacaacacatctttctcgaactcaagtacaagctcaaggtcgaggacctgcccgcc
gccgctccccttgtcacgggcggtgcacccggcggtgtcttccgcgacgcgctggcgggt
cttgcgaacctcggctacggcgaggaagaggcctcacacgtgctcaaggaagtgctccac
ggtgagccggacctcgacgtggggggcgcgttgcgcgccgcattgcgcgccctggcgagg
ggacgctag

DBGET integrated database retrieval system