KEGG   Desulfovibrio vulgaris DP4: Dvul_0993Help
Entry
Dvul_0993         CDS       T00452                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dvul_0993
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_0993
   00620 Pyruvate metabolism
    Dvul_0993
   00640 Propanoate metabolism
    Dvul_0993
  Energy metabolism
   00680 Methane metabolism
    Dvul_0993
Enzymes [BR:dvl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dvul_0993
Lipid biosynthesis proteins [BR:dvl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dvul_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1220234..1221889
Genome map
AA seq 551 aa AA seqDB search
MDKLTFASYDEFLRVFSLDAPETFNFAFDVLDAMANETPDRLAIAHVDDAGVRRDYTFAW
LADASARLANALKARGVRKGHRVMLVLHRRIEFWVSMLALHRLGAVAIPAPAQLTPKDIV
FRVERAQVRAVIVDDGITDRIEAARPDCPTLSVLVQCGGTPLPDGWCDYEALCTDASPSF
PRPTAPDELACGEDPLLIFFSSGTTGMPKMVEHVHTYPLGHLVTGMYWHDLRPGDLHLTV
ADTGWGKAVWGKFYGQWMAGAAVFVYDFRGKFDPEALLDVVAKNGVTTFCAPPTVYRFLV
RADLSRYDLSKLRHCTTAGELLNESVFHGWKAATGLSIYEGYGQTETTLQIATLSCMEAK
PGSIGRPMPGWGITLLDHEGKECPAGEEGEICIRISDGLPVGLFRGYVEDAEKTASVMFD
GYYHTGDKAWMDEDGYLWFLGRVDDLIKSSGYRIGPFEVESALVAHPAVVEAAVTGVPDP
LRGQAVKATIVLAAGYEAGEVLTKELQDHVKKVTAPYKYPRIVEYVAELPKTISGKIKRA
EIRQRDSEKSA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggataagctcacctttgccagctacgacgagttcttgcgtgtcttctcgctggatgcg
ccagagaccttcaatttcgccttcgacgttctcgatgccatggccaacgagactcccgac
aggctcgccattgcccacgtcgatgacgccggggtgcggcgcgactacaccttcgcatgg
cttgccgacgcttctgcgcggcttgccaacgcgctcaaggccagaggtgtgcgcaagggc
catcgggtcatgctggtcttgcaccggcgtatcgaattctgggtctccatgctggcattg
catcgtctcggcgcggtagccattcccgcccccgcgcaactgacccccaaggatatcgtg
ttccgcgtcgaacgcgcgcaggttcgtgccgtcatcgtcgacgacggcatcaccgaccgt
atcgaggccgcgcgtcccgactgtccgaccctttcagtgctcgtgcagtgcggcgggaca
ccgttgcccgatggctggtgcgactacgaggccctctgtacggatgcctcgccctctttc
ccgcgcccgacagcacccgacgaacttgcctgcggcgaagacccgctgctcatattcttc
tcgtccggcaccacgggcatgccgaagatggtggaacatgtgcacacctatcccctcggg
cacctcgtgacgggcatgtactggcacgacctgcgccccggcgacctgcacctcaccgtg
gccgacacgggttggggcaaggccgtgtggggcaagttctacgggcagtggatggcgggg
gcagccgtcttcgtctacgacttccgtggcaagttcgaccccgaagcgttgctcgatgtc
gttgcgaagaacggcgtcaccaccttctgcgccccgcccaccgtgtaccgctttctcgtg
cgggccgacctttcgcgttacgacctctcgaagctgcgccactgcacaacggcaggtgaa
ctgctcaacgagagcgtgttccacgggtggaaggccgcgacgggcctttccatctacgag
ggatacggccagaccgagaccacgttgcagatcgccacgctctcgtgcatggaggccaag
cccggttccatcgggcgccccatgccggggtggggcatcacgcttctcgaccacgagggc
aaggaatgtccggcgggcgaagagggcgaaatctgcatccgcatcagcgacggactgcct
gtgggccttttccggggctatgtggaggacgccgagaagaccgcatcggtcatgttcgac
gggtactaccacaccggcgacaaggcgtggatggacgaggacggctacctctggttcctc
gggcgtgtggacgacctcatcaagagttcgggctatcgcatcgggcccttcgaggtcgag
agtgccctcgtggcccatcctgccgtcgtcgaggccgccgtcaccggcgtgcccgacccg
ttgcgcgggcaggccgtgaaggccaccatcgtgcttgccgcaggctacgaggcgggcgag
gtgctcacgaaggagttgcaggaccacgtcaagaaggtcaccgccccctacaagtacccc
cgcatcgtcgaatacgtggcagagttgcccaagaccatcagcggcaagatcaaacgcgcc
gaaatacgccagcgcgatagcgaaaagagcgcatag

DBGET integrated database retrieval system