KEGG   Desulfovibrio vulgaris DP4: Dvul_0999Help
Entry
Dvul_0999         CDS       T00452                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dvul_0999
Enzymes [BR:dvl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dvul_0999
Exosome [BR:dvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvul_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1228159..1230081
Genome map
AA seq 640 aa AA seqDB search
MTIPCSRPLFIEPFDLYLFGMGRHRHLYRILGAHPAVQDGEAGYRFAVWAPNARSVHLSG
DCNGWRHEGCPLFPVGVSGVWAAFVPGVRRGSLYKFVVRGADGRQEQKADPFALWAEMRP
GVASVAWDIDNHAWGDGAWMAERARQGLPLERPVSIYEVHLGSWRRRHGDGHPFLTYDEL
GDQLIPYATGMGFTHLELLPVAEHPLDQSWGYQTGHYYAPTSRFGSPEGFKRFVDRCHQA
GLGVILDWVPAHFPRDAWSLGRFDGTALYEHLDPRLGEHPDWGTYIFNYGRNEVRNFLTA
NALYWLREFHIDGLRMDAVASMLYLDYSREAGQWLPNRHGGRENLDAVDFLREVNTVIHA
EFPGAMTLAEESTAWPGVSRPVYTGGLGFSFKWNMGWMHDTLGYLAEDPIHRAYHHGSLT
FSMLYAFSENFVLPLSHDEVVHGKGALLSKMPGDMWQQQANLRLLYAYQWAHPGKKLLFM
GGEFGQWNEWDESRELDWCLYRFPAHEGIARLVGDLNRLLRSEPAMHRRDHDWSGFRWVD
FADYGSSVISFLRLAEGERPLLWIFNFTPVVRRFYRVPCPRGGTWRELCNTDSAYYGGSD
VGNAGAVMAREDHWGGGHFIELTLPPLAAMCFAPVTGQGT
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattccgtgcagccgtcccctgttcatcgagcctttcgacctctacctcttcggc
atggggcggcacaggcacctctaccgcattctcggcgcacacccggccgtacaggatggc
gaggcgggctatcgctttgcggtgtgggcccccaatgcccgttccgtgcacctgtccggc
gactgcaacggttggaggcatgagggctgcccccttttccccgtgggggtgtcgggcgta
tgggccgccttcgtgcccggagtgcgccgcgggtcgctttacaagttcgtggtgcgtggg
gccgatggtcggcaagagcagaaggccgaccccttcgccctgtgggcggagatgcgcccc
ggggtggcgtcggtggcatgggatatcgacaaccatgcatggggcgacggggcgtggatg
gctgaacgggcgcgtcaggggctgcccctcgaacgtccggtctccatctacgaggtgcat
ctcgggtcgtggcggcgcaggcatggcgacggccatccgttcctgacctacgatgaactg
ggcgaccagctcattccctatgccactggcatgggtttcacccacctcgaactgctgccc
gtggcggaacaccccctcgaccagtcgtgggggtaccagacggggcactactacgcgccg
acctcgcgtttcggttcgccggaagggttcaagcggttcgtcgacaggtgccatcaggca
gggcttggcgtcatcctcgactgggtcccggcccatttcccgcgggacgcatggagtctt
gggcgtttcgatggcacggcgctgtatgagcacctcgacccgcgccttggcgaacacccc
gactggggaacctacatcttcaactacgggcgcaacgaggtgcgcaacttcctcaccgcc
aatgccctgtactggctgcgggagttccacatcgacggtctgcgcatggacgccgtggcg
tccatgctctacctcgactactcgcgcgaagcggggcagtggctgcccaacaggcatggc
ggacgcgagaacctcgatgccgtggacttcctgcgcgaggtcaacacggtcatccatgcc
gagtttcccggtgccatgacgctggcggaggaatccaccgcatggcccggtgtctcccgt
ccggtctacacgggcggactggggttcagcttcaagtggaacatgggctggatgcatgac
acgctgggttaccttgcagaagacccgatacaccgggcctatcaccacggttcgctgacc
ttctccatgctctacgccttcagcgagaatttcgtgctgccgctgtcacatgacgaggtc
gtgcacggcaagggggcgctgctgtccaagatgcccggcgacatgtggcagcaacaggcc
aacctgcggttgctctatgcctaccagtgggcgcatcccggcaagaagctgctgttcatg
gggggcgaattcggccagtggaacgagtgggacgaaagccgcgaactggactggtgtctc
taccgtttccccgcccatgagggcatcgcgcggctggtgggcgacctcaaccggttgctg
cgttccgaacctgccatgcacaggcgcgaccacgactggtcgggcttccgctgggtggat
ttcgcggactacggcagttcggtgatcagtttcctccggctggccgaaggtgaacgacct
ctcctgtggattttcaacttcacgccggtggtgcggcgcttctaccgtgtgccctgtccg
cgtggcggcacatggcgtgagctgtgcaacaccgacagtgcctactacggcggcagtgac
gtgggtaacgccggtgccgtcatggcacgggaagaccactggggtggcgggcacttcatc
gaactgacgctacccccgcttgccgccatgtgcttcgcccccgtgacagggcagggcacc
tag

DBGET integrated database retrieval system