KEGG   Desulfovibrio vulgaris DP4: Dvul_1167Help
Entry
Dvul_1167         CDS       T00452                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dvul_1167
   01230 Biosynthesis of amino acids
    Dvul_1167
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_1167
   00030 Pentose phosphate pathway
    Dvul_1167
   00051 Fructose and mannose metabolism
    Dvul_1167
   00052 Galactose metabolism
    Dvul_1167
  Energy metabolism
   00680 Methane metabolism
    Dvul_1167
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dvul_1167
Protein phosphatases and associated proteins [BR:dvl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dvul_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1428511..1429845)
Genome map
AA seq 444 aa AA seqDB search
MPGTRFEKDGLVIDTTIPHLGPAKIPSPLVYCHHTNDTGVPLYLDSEFIEELAGESTALN
FEAAGPRRNLYFDPSKAKCAIVTCGGLCPGINDVIRAIVMEARHAYDVPAVLGIRYGLEG
FIPKYRHDVVELTPDVVSDIHQFGGTILGSSRGPQSPEEIVDALERMNISALFMIGGDGT
LKAASSIVQEVMRRNLKISVIGVPKTIDNDINFISQSFGFETAVYKATEAIQCAHTEAIG
AMNGIGLVKLMGRESGFIAAHATLSLKEVNFVLIPEAPFTLHGEGGLLPTLERRLRARAH
AVIVVAEGAGQNLLADTGKKDASGNPILGDIAQLLRAEIKAYCDERGLPHTLKYIDPSYI
IRSVPANANDRVYCGFLGQHAVHAAMAGRTGMVVAKLMDRYVHLPLELVTLRRRKLNIRS
DYWRAVLESTGQAELAGMVPGLDE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacgcgtttcgagaaggatggccttgtcatcgacaccaccatccctcatctc
ggccccgccaagataccctcccctctggtctactgccatcacaccaacgacaccggtgta
ccgctgtacctcgactccgagttcatcgaagaactggccggtgagagcactgccctcaac
ttcgaagcggccgggccgcgccgtaatctctacttcgacccgtcaaaggccaagtgcgcc
atcgtcacctgcggtggcctgtgccccggcatcaacgacgtcatccgggccatcgtcatg
gaggcccgccacgcctacgacgtgcccgccgtgctgggcatccggtacgggcttgaaggt
ttcatccccaaataccgccatgacgtggtcgaactgacgcccgatgtcgtgtcggacatc
catcaattcggtgggaccatcctcggttcgtcacgcggcccgcagtcgccggaagagatc
gtcgacgccctcgaacgcatgaacatcagcgcactcttcatgatcggcggcgacgggacc
ctcaaggcggcctccagcatcgtgcaggaggtgatgcgccgcaatctcaagatttcggtc
atcggcgtccccaagaccatcgacaacgacatcaacttcatcagccagtcgttcggcttc
gaaacagcggtgtacaaggccaccgaagccatccagtgcgcccataccgaggccatcggc
gccatgaacggcatcggtctcgtcaaactcatggggcgcgagtcgggcttcatcgccgca
cacgccacgctttcgctcaaagaggtcaacttcgtcctcatccccgaagcccccttcacc
ctgcatggcgagggcggcctgctaccgacgctcgaacgccgtctgcgcgcccgggcccac
gccgtcatcgtggtcgccgaaggtgcggggcagaatctgctggctgacacgggcaagaag
gacgcctcgggcaaccccatcctcggcgacatagcccagctgctgcgtgccgaaatcaag
gcatactgcgacgaacgcggcctgccgcacacgctcaagtacatcgaccccagctacatc
atccgctccgtgcccgccaacgccaacgaccgcgtctactgcggcttcctcggccagcat
gcggtacacgcggccatggccggacgcaccggcatggtcgtggcgaagctcatggacagg
tacgtgcatctgccccttgaacttgtcacgctgcgcaggcgcaagctcaacatccgctcc
gactactggcgcgccgtgcttgaatcgaccggacaggccgaacttgccggcatggtgccc
ggtctcgacgaataa

DBGET integrated database retrieval system