KEGG   Desulfovibrio vulgaris DP4: Dvul_1167Help
Entry
Dvul_1167         CDS       T00452                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00010  Glycolysis / Gluconeogenesis
dvl00030  Pentose phosphate pathway
dvl00051  Fructose and mannose metabolism
dvl00052  Galactose metabolism
dvl00680  Methane metabolism
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
dvl01130  Biosynthesis of antibiotics
dvl01200  Carbon metabolism
dvl01230  Biosynthesis of amino acids
dvl03018  RNA degradation
Module
dvl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_1167
   00030 Pentose phosphate pathway
    Dvul_1167
   00051 Fructose and mannose metabolism
    Dvul_1167
   00052 Galactose metabolism
    Dvul_1167
  Energy metabolism
   00680 Methane metabolism
    Dvul_1167
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dvul_1167
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dvul_1167
Protein phosphatases and associated proteins [BR:dvl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dvul_1167
Messenger RNA biogenesis [BR:dvl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dvul_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABM28187
JGI: Dvul1167
UniProt: A0A0H3A775
Position
complement(1428511..1429845)
Genome map
AA seq 444 aa AA seqDB search
MPGTRFEKDGLVIDTTIPHLGPAKIPSPLVYCHHTNDTGVPLYLDSEFIEELAGESTALN
FEAAGPRRNLYFDPSKAKCAIVTCGGLCPGINDVIRAIVMEARHAYDVPAVLGIRYGLEG
FIPKYRHDVVELTPDVVSDIHQFGGTILGSSRGPQSPEEIVDALERMNISALFMIGGDGT
LKAASSIVQEVMRRNLKISVIGVPKTIDNDINFISQSFGFETAVYKATEAIQCAHTEAIG
AMNGIGLVKLMGRESGFIAAHATLSLKEVNFVLIPEAPFTLHGEGGLLPTLERRLRARAH
AVIVVAEGAGQNLLADTGKKDASGNPILGDIAQLLRAEIKAYCDERGLPHTLKYIDPSYI
IRSVPANANDRVYCGFLGQHAVHAAMAGRTGMVVAKLMDRYVHLPLELVTLRRRKLNIRS
DYWRAVLESTGQAELAGMVPGLDE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacgcgtttcgagaaggatggccttgtcatcgacaccaccatccctcatctc
ggccccgccaagataccctcccctctggtctactgccatcacaccaacgacaccggtgta
ccgctgtacctcgactccgagttcatcgaagaactggccggtgagagcactgccctcaac
ttcgaagcggccgggccgcgccgtaatctctacttcgacccgtcaaaggccaagtgcgcc
atcgtcacctgcggtggcctgtgccccggcatcaacgacgtcatccgggccatcgtcatg
gaggcccgccacgcctacgacgtgcccgccgtgctgggcatccggtacgggcttgaaggt
ttcatccccaaataccgccatgacgtggtcgaactgacgcccgatgtcgtgtcggacatc
catcaattcggtgggaccatcctcggttcgtcacgcggcccgcagtcgccggaagagatc
gtcgacgccctcgaacgcatgaacatcagcgcactcttcatgatcggcggcgacgggacc
ctcaaggcggcctccagcatcgtgcaggaggtgatgcgccgcaatctcaagatttcggtc
atcggcgtccccaagaccatcgacaacgacatcaacttcatcagccagtcgttcggcttc
gaaacagcggtgtacaaggccaccgaagccatccagtgcgcccataccgaggccatcggc
gccatgaacggcatcggtctcgtcaaactcatggggcgcgagtcgggcttcatcgccgca
cacgccacgctttcgctcaaagaggtcaacttcgtcctcatccccgaagcccccttcacc
ctgcatggcgagggcggcctgctaccgacgctcgaacgccgtctgcgcgcccgggcccac
gccgtcatcgtggtcgccgaaggtgcggggcagaatctgctggctgacacgggcaagaag
gacgcctcgggcaaccccatcctcggcgacatagcccagctgctgcgtgccgaaatcaag
gcatactgcgacgaacgcggcctgccgcacacgctcaagtacatcgaccccagctacatc
atccgctccgtgcccgccaacgccaacgaccgcgtctactgcggcttcctcggccagcat
gcggtacacgcggccatggccggacgcaccggcatggtcgtggcgaagctcatggacagg
tacgtgcatctgccccttgaacttgtcacgctgcgcaggcgcaagctcaacatccgctcc
gactactggcgcgccgtgcttgaatcgaccggacaggccgaacttgccggcatggtgccc
ggtctcgacgaataa

DBGET integrated database retrieval system