KEGG   Desulfovibrio vulgaris DP4: Dvul_1245Help
Entry
Dvul_1245         CDS       T00452                                 

Definition
nickel-dependent hydrogenase, large subunit
Orthology
K00437  
[NiFe] hydrogenase large subunit [EC:1.12.2.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Brite
Enzymes [BR:dvl01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.2  With a cytochrome as acceptor
    1.12.2.1  cytochrome-c3 hydrogenase
     Dvul_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1522845..1524545)
Genome map
AA seq 566 aa AA seqDB search
MGGCKAKTAPGVPVTPQSSYTGPITIDPVTRIEGHLRIEVEVENGKVKRAYSSSTLFRGL
EIILKGRDPRDAQHFTQRTCGVCTYTHALASTRCVDNAVGVHIPKNATYIRNLVLGAQYL
HDHIVHFYHLHALDFVDVTNALKADPAKAAKIASSISPRKTTAADLKAVQDKLKAFVASG
QLGPFTNAYFLGGHPAYYLEPELDLIATAHYLEALRLQVKAARAMAVFGAKNPHTQFTVV
GGVTCYDALTPKRIQEFTDLWKETKAFVDEVYIPDLLAVASRYKDWTQYGGTTNFITFGE
FPKDEYDLNSRFFRPGAVFKRDIQNIKPFDPMQIREHVRHSWYEGAEARHPWKGATEPKY
TDLHGEDRYSWMKAPRYMDEPMETGPLAQVLVAYAQGHKQVKAVTDTVLGALGVGPEALF
STLGRTAARGIETAVIAAQMEQWLNEYKDNIASGDNKIVEPWEMPKQAEGVGFVTAPRGG
LSHWIRIEDGRIGNFQLVVPSTWTLGPRCANNKPSPVEEALVGTPVADAKRPVEILRTVH
SFDPCIACGVHVIDSQTNEVHKFRIL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggcggctgcaaagccaagacagctccgggtgtgcccgtcacgccacagagcagctat
accggccccatcaccatcgaccctgtgacccgaatcgaaggccaccttcgcatcgaagtc
gaggtcgaaaacggcaaggtgaagcgcgcatacagcagttcgacgctcttcagggggctt
gagatcatcctgaagggacgcgacccgcgcgatgcgcagcacttcactcagcgcacctgc
ggcgtgtgcacctacacgcatgcgctggcttccacgcgctgcgtcgacaacgcggtgggt
gtgcatatccccaagaatgccacatacatccgcaacctcgttctgggtgcgcagtatctg
cacgaccacatcgtgcacttctaccacctgcacgcgctcgacttcgtcgacgtgaccaac
gccctcaaggccgacccggccaaggctgcgaagatcgcgtcatccatatcgccccgcaag
acaacggcggccgacctcaaggccgtacaggacaagctcaaggcgttcgtggccagcggg
caactcggccccttcaccaacgcctacttcctcggcggtcaccccgcctactatctcgaa
cccgaactcgacctcatcgccacggcccactacctcgaagcccttcggcttcaggtcaag
gccgcccgcgccatggccgtcttcggtgccaagaacccgcacacccagttcaccgtggtg
ggcggggtcacctgctacgacgcgctcacgcccaagcgcatccaggaattcaccgacctc
tggaaagagacgaaggccttcgtcgatgaggtgtacatccccgacctgctggcggtggca
tcgcgctacaaggactggacacagtacggtggcaccaccaacttcatcaccttcggcgag
ttccccaaggacgaatacgacctgaacagccgtttcttcagacccggcgcggtgttcaag
cgcgacatccagaacatcaagccgttcgaccccatgcagattcgcgaacacgtgcggcac
agctggtacgaaggtgccgaagcgcgccacccgtggaagggtgcgaccgaacccaagtac
accgacctgcacggagaggaccgctactcgtggatgaaggccccgcgctacatggacgaa
cccatggagaccggccccctcgcgcaggtgctggtggcctatgcgcagggccacaagcag
gtgaaggcggtcaccgacaccgtactcggcgctcttggcgtcggtcccgaagccctgttc
tccacactgggacgcacggcggcgcgcggcatcgagaccgcggtcatcgccgcccagatg
gaacagtggctgaacgagtacaaggacaacatcgccagcggcgacaacaagatcgtcgag
ccatgggagatgcccaagcaggctgagggtgtcggcttcgtcaccgcaccacgcggcggc
ctctcgcactggatacgcatcgaggacggacgcatcggcaacttccagcttgtcgttccc
tcgacgtggacgcttggcccccgctgtgcgaacaacaagcccagccccgtcgaagaggca
ctggtgggaaccccggtcgcggacgcgaagcgccccgtcgagattctgcgcaccgtccac
tccttcgacccgtgcatcgcctgtggcgtacacgtcatcgactcgcagaccaacgaagta
cacaagttccgcatcctgtag

DBGET integrated database retrieval system