KEGG   Desulfovibrio vulgaris DP4: Dvul_1313Help
Entry
Dvul_1313         CDS       T00452                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dvl  Desulfovibrio vulgaris DP4
Brite
Enzymes [BR:dvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dvul_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_23 Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 CMAS Methyltransf_32 GCD14 Glu_dehyd_C SAM_MT TPMT DUF938
Motif
Other DBs
NCBI-ProteinID: ABM28331
JGI: Dvul1313
UniProt: A1VD15
Position
1602375..1602968
Genome map
AA seq 197 aa AA seqDB search
MPRGISDEAVLAAMGCVPRHLFVQEALRAQAYEDHPLPIGNGQTISQPFIVAFMSQLLEA
KPGMRVLEIGTGSGYQAAVLAEMGLDVYTVERIREIYQTTRDLLRALRYTRIRCRLDDGT
LGWPESAPFDRIIVTAGGPEIPVPLVEQLADPGVMVLPVGVSRRSQELVVVRKRDGKLFR
SNRGGVSFVDLVGCHGW
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtggcatttccgacgaggccgtgctggctgccatggggtgcgttccgagacat
cttttcgtgcaagaggcccttcgggctcaggcatatgaagatcatccgctccccatcggc
aacggacagaccatctcccaaccgttcatcgtggcgttcatgtcgcagttgctcgaagcc
aagccggggatgcgtgtgctggagataggcacgggctcaggctaccaggcggcggtgctc
gcagagatgggccttgatgtctatacggtcgaacgcatccgtgaaatctaccagacaacc
cgcgacctgctgcgtgccctgcgctacacgcgcatccggtgcaggcttgatgacggaacg
ctcggatggcccgaatctgcacctttcgaccgcatcatcgtcaccgcgggaggccccgaa
atccccgtccctctggtcgaacaactggcagaccccggcgtgatggtgctccctgtcggt
gtgtcgcgacgttcgcaggagcttgtcgtcgtgcgcaaacgtgacggaaagctcttccgt
tccaatcgcggtggggtgagtttcgtcgaccttgtcggctgtcacggctggtag

DBGET integrated database retrieval system