KEGG   Desulfovibrio vulgaris DP4: Dvul_1313Help
Entry
Dvul_1313         CDS       T00452                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dvl  Desulfovibrio vulgaris DP4
Brite
Enzymes [BR:dvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dvul_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1602375..1602968
Genome map
AA seq 197 aa AA seqDB search
MPRGISDEAVLAAMGCVPRHLFVQEALRAQAYEDHPLPIGNGQTISQPFIVAFMSQLLEA
KPGMRVLEIGTGSGYQAAVLAEMGLDVYTVERIREIYQTTRDLLRALRYTRIRCRLDDGT
LGWPESAPFDRIIVTAGGPEIPVPLVEQLADPGVMVLPVGVSRRSQELVVVRKRDGKLFR
SNRGGVSFVDLVGCHGW
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtggcatttccgacgaggccgtgctggctgccatggggtgcgttccgagacat
cttttcgtgcaagaggcccttcgggctcaggcatatgaagatcatccgctccccatcggc
aacggacagaccatctcccaaccgttcatcgtggcgttcatgtcgcagttgctcgaagcc
aagccggggatgcgtgtgctggagataggcacgggctcaggctaccaggcggcggtgctc
gcagagatgggccttgatgtctatacggtcgaacgcatccgtgaaatctaccagacaacc
cgcgacctgctgcgtgccctgcgctacacgcgcatccggtgcaggcttgatgacggaacg
ctcggatggcccgaatctgcacctttcgaccgcatcatcgtcaccgcgggaggccccgaa
atccccgtccctctggtcgaacaactggcagaccccggcgtgatggtgctccctgtcggt
gtgtcgcgacgttcgcaggagcttgtcgtcgtgcgcaaacgtgacggaaagctcttccgt
tccaatcgcggtggggtgagtttcgtcgaccttgtcggctgtcacggctggtag

DBGET integrated database retrieval system