KEGG   Desulfovibrio vulgaris DP4: Dvul_1336Help
Entry
Dvul_1336         CDS       T00452                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Brite
Enzymes [BR:dvl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dvul_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1630101..1630895
Genome map
AA seq 264 aa AA seqDB search
MGEVGGTGGTMTGGACLLIHGFGGAPFEMEPLAVALSEAGVEAHVITLPGHDATLEDFEA
TCFDDWARHADECYRDLEARAGRVVVVGLSMGGTLALHLGCRFRPAGVVALAAPVFLYRA
VPFVMQDWRLPFVGLLKRVRRRWPVPCRKPEATAVAPWRGYDGVMALPQLHSLIKGMGQV
ERELPLLVAPLLLMHARGDRTVPVENALHIARRVTSDDVCVRLFGLADRVAGHHLITTHR
ESRSFVAREVVSFTQRALSQNCKK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggtcgggggcactggaggaacaatgaccggaggggcatgtctgctcattcac
ggtttcggcggggcgccgttcgagatggaaccgctggccgttgcgttgtccgaggccggg
gtcgaggcacacgtcatcaccctgcccgggcatgatgcgacacttgaagatttcgaggcc
acctgtttcgacgactgggcgcgccatgccgacgagtgctaccgcgaccttgaggcacgc
gcggggcgcgttgtggtcgtcggtctttccatgggcggaacgcttgccctgcacctgggc
tgccgcttccggcccgccggggttgtcgcccttgccgcacctgtcttcctgtaccgtgcc
gtgccgttcgtcatgcaggactggcgcctacccttcgtagggttgctcaagcgggtgcgg
cgtcgatggcctgtgccgtgccgcaagcccgaggccacagccgtggcgccgtggcgcggt
tatgacggggtcatggcgttgccgcagctgcacagcctcatcaaggggatggggcaggtt
gagcgggagttgccactgctggtggccccgcttcttctgatgcacgcccgcggcgaccgt
accgtgcctgtggagaatgcccttcacatcgcacgacgcgtgacgtcggatgatgtctgt
gtacggttgttcgggctcgccgacagggtggcagggcatcatctcatcacgacccatcgc
gagagtcggagctttgtcgctcgtgaagtcgtttcgtttacgcaaagagcattgtctcaa
aattgtaaaaaatag

DBGET integrated database retrieval system