KEGG   Desulfovibrio vulgaris DP4: Dvul_1410Help
Entry
Dvul_1410         CDS       T00452                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00010  Glycolysis / Gluconeogenesis
dvl00051  Fructose and mannose metabolism
dvl00562  Inositol phosphate metabolism
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
dvl01130  Biosynthesis of antibiotics
dvl01200  Carbon metabolism
dvl01230  Biosynthesis of amino acids
Module
dvl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dvl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_1410
   00051 Fructose and mannose metabolism
    Dvul_1410
   00562 Inositol phosphate metabolism
    Dvul_1410
Enzymes [BR:dvl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dvul_1410
Exosome [BR:dvl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dvul_1410
  Exosomal proteins of bladder cancer cells
   Dvul_1410
  Exosomal proteins of melanoma cells
   Dvul_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM28428
JGI: Dvul1410
UniProt: A1VDB2
Position
1711229..1711984
Genome map
AA seq 251 aa AA seqDB search
MKKLIAANWKMYKTIDEARATGRELVSAVAGSLPADREVLVCPPFTALHALHDTFKDVEG
FAIGGQDVYPATEGAYTGEIAPGMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSLK
AGLRVVLCIGEKLDEREAGRLEDVLAHQLQVGLADVDATYVPQSLVVAYEPVWAIGTGKV
AGPAEVVEAHALVRSLLEARYGRDGAAIRILYGGSVKPDNAAELLSLDNVDGLLVGGASL
QAVSFSRIILA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcatcgccgccaattggaaaatgtacaagaccatcgacgaggctagggct
acgggacgcgaacttgtgtccgccgtcgccgggtcactgcccgcagaccgtgaggtgctc
gtgtgcccccccttcacggcgctccatgcccttcatgacaccttcaaggacgtcgagggg
tttgccatcggcgggcaggatgtctacccggctaccgaaggtgcctacaccggcgaaatc
gctcccggcatgttgctcgatgccggatgcggatgggtgctcaccgggcactctgaacgg
cgtcatattctcggtgaggacgacgagacggtcgcgcgcaagacggctttcagcctgaag
gccggactgcgtgtggtactgtgcatcggcgaaaagcttgatgaacgtgaggctggcagg
cttgaagacgtgctggcgcatcagctgcaggtcgggcttgcagatgtcgacgcgacctat
gtaccccagtcgcttgtggtggcctacgaacccgtatgggctatcggtacgggcaaggtg
gcggggcctgccgaagtcgtcgaggctcacgctcttgtccgttcgctactcgaagcccgt
tacggtcgcgacggtgccgccatacgcatcctgtacgggggcagcgtgaagcctgacaac
gccgcagaactactttctcttgacaatgtcgacggtctgctggtaggaggcgcttctttg
caggctgtcagcttcagccgcatcattctggcatga

DBGET integrated database retrieval system