KEGG   Desulfovibrio vulgaris DP4: Dvul_1410Help
Entry
Dvul_1410         CDS       T00452                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dvul_1410
   01230 Biosynthesis of amino acids
    Dvul_1410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_1410
   00051 Fructose and mannose metabolism
    Dvul_1410
   00562 Inositol phosphate metabolism
    Dvul_1410
Enzymes [BR:dvl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dvul_1410
Exosome [BR:dvl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dvul_1410
  Exosomal proteins of bladder cancer cells
   Dvul_1410
  Exosomal proteins of melanoma cells
   Dvul_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1711229..1711984
Genome map
AA seq 251 aa AA seqDB search
MKKLIAANWKMYKTIDEARATGRELVSAVAGSLPADREVLVCPPFTALHALHDTFKDVEG
FAIGGQDVYPATEGAYTGEIAPGMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSLK
AGLRVVLCIGEKLDEREAGRLEDVLAHQLQVGLADVDATYVPQSLVVAYEPVWAIGTGKV
AGPAEVVEAHALVRSLLEARYGRDGAAIRILYGGSVKPDNAAELLSLDNVDGLLVGGASL
QAVSFSRIILA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcatcgccgccaattggaaaatgtacaagaccatcgacgaggctagggct
acgggacgcgaacttgtgtccgccgtcgccgggtcactgcccgcagaccgtgaggtgctc
gtgtgcccccccttcacggcgctccatgcccttcatgacaccttcaaggacgtcgagggg
tttgccatcggcgggcaggatgtctacccggctaccgaaggtgcctacaccggcgaaatc
gctcccggcatgttgctcgatgccggatgcggatgggtgctcaccgggcactctgaacgg
cgtcatattctcggtgaggacgacgagacggtcgcgcgcaagacggctttcagcctgaag
gccggactgcgtgtggtactgtgcatcggcgaaaagcttgatgaacgtgaggctggcagg
cttgaagacgtgctggcgcatcagctgcaggtcgggcttgcagatgtcgacgcgacctat
gtaccccagtcgcttgtggtggcctacgaacccgtatgggctatcggtacgggcaaggtg
gcggggcctgccgaagtcgtcgaggctcacgctcttgtccgttcgctactcgaagcccgt
tacggtcgcgacggtgccgccatacgcatcctgtacgggggcagcgtgaagcctgacaac
gccgcagaactactttctcttgacaatgtcgacggtctgctggtaggaggcgcttctttg
caggctgtcagcttcagccgcatcattctggcatga

DBGET integrated database retrieval system