KEGG   Desulfovibrio vulgaris DP4: Dvul_1557Help
Entry
Dvul_1557         CDS       T00452                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00900  Terpenoid backbone biosynthesis
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01130  Biosynthesis of antibiotics
Module
dvl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dvul_1557
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dvul_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABM28574
JGI: Dvul1557
UniProt: A1VDQ8
Position
1847238..1848098
Genome map
AA seq 286 aa AA seqDB search
MNDAVTLRSGCKVNLDLHITSRRDDGYHEIDSLFLPLDEPHDELVVTVGDAPGITVTCAI
QGIDPTRNTVTRAYDAYAEASGFRPPLRVELRKGVPHGAGLGGGSANAAAILNHLESIAP
HPLGRETLCRLAARIGADVPFFIHAVPCRASGIGEIITPVAWPYKGFTLLLACPQVQVST
AWAYGALDAAEEKQLRVRGCLTTGGVADRNSFSRESWLHNSFEPVVFASHPELRSLKEAL
LRHGAAAALMSGSGASVFALFRRREDAEAAFEQLKGHDIRVYQHLL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcggtgacgctccgttccgggtgcaaggtcaatctcgacctccatatcacg
tcgcgccgtgacgacggctatcacgaaatcgacagcctcttccttccgctggatgaaccg
cacgacgaactggtggtgacggttggcgatgctcccggaataactgtgacgtgtgccatt
cagggcatcgacccgacacggaacactgtcacccgcgcctacgacgcctatgccgaagcc
tccggattccgcccgcctcttcgcgtcgagttgcgaaaaggcgttccgcatggggcagga
ctgggaggcggcagtgccaacgccgctgcaatcctgaaccacctcgaatccatcgccccg
catcccctcggaagagagacgctatgcagactggcggcccgcatcggagccgacgtgccg
ttcttcatccatgcggtcccgtgccgtgccagcggcattggcgagatcatcacccctgtg
gcatggccgtacaagggattcaccctgcttctcgcctgcccgcaggtacaggtctccacg
gcatgggcctacggcgcgctggatgctgccgaagaaaaacaactccgcgtgcgtggttgc
ttgacaacggggggggttgcggatagaaactcgttctcccgcgagtcatggctccataac
agcttcgaaccggtggtcttcgcgtctcacccggagctgcggtcgctcaaggaagccttg
ttgcgacatggcgcggcagccgccctcatgagcggtagcggcgcgagcgtcttcgccctc
ttcaggaggcgtgaagatgccgaagcggccttcgaacagctgaagggtcatgacatacgg
gtatatcagcatcttttgtga

DBGET integrated database retrieval system