KEGG   Desulfovibrio vulgaris DP4: Dvul_2055Help
Entry
Dvul_2055         CDS       T00452                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dvul_2055
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dvul_2055
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Dvul_2055
Enzymes [BR:dvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dvul_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2395516..2396658)
Genome map
AA seq 380 aa AA seqDB search
MEWTEERAAALREARCVVVKVGSAVLTTETGVNLAVIDSLAAQLSALQESGKRVVLVSSG
AVAAGRSALRDCCEIAGMPHKQAASAVGQSRLMHHYDEAFARYGHLSAQVLLTRDDLRNR
ERFLNARNTFQALLDWGVIPVVNENDTVAVQELKFGDNDCLASLLLNVVEGDLYVNLTSA
SGVYADNPQTNPEAGILPCIEDVHTLDLDVMCGGKTSVGTGGMYSKLLAASRAAQLGVPT
LILPGREPRILERAFSGEPVGTWVRPEARVVSRRKYWLAYQSEPSGTVTVDEGAARALLQ
QGGSLLPGGVCDVSGAFEPGALVRIAGPDGTVIAVGLSNYGDRDLVRIKGHRRHEVAAIL
GDAHFPEVVHRDNMLLDAVV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagtggacggaggaacgcgccgcagccctgcgcgaggcgcgttgcgtagtggtcaag
gtgggcagtgccgtgctgaccaccgaaacgggcgtcaatcttgccgtcatcgacagtctc
gccgcccagctttcggccttgcaggaatctggcaagcgggtggtgctcgtctcttcgggt
gctgtggctgccgggcgcagtgccttgcgcgactgctgcgagattgccggaatgccgcat
aagcaggcggcttcggccgtagggcaaagccgtctcatgcatcactatgacgaggcgttc
gcccgttacgggcatctctcggcgcaagtgcttctcacccgggacgacctgcggaaccgc
gagcgttttctcaacgcacgcaacacgttccaggcgcttctcgactggggggtcatcccg
gtcgtcaacgagaacgacaccgtagcggtgcaggaactcaagttcggcgacaacgactgc
cttgccagcctgctgctcaacgtcgtcgagggcgacctgtacgtcaacctcacctccgcg
tcgggtgtctatgccgacaacccgcagaccaatcccgaagccggtatcctgccgtgcatc
gaggacgtgcacacgctcgacctcgatgtgatgtgcggaggcaagacgtctgtcggtacc
ggcggcatgtactccaagctactggctgcaagccgcgccgcacaactgggggtgccgacg
ctcattcttccggggcgtgaaccgcgcatcctcgaacgtgccttctcgggtgaacccgtg
gggacatgggtgcgccccgaggcacgagtcgtgtcgcgccgcaagtactggctggcgtac
cagtccgaaccttcggggacggtgacggtggacgagggtgctgcccgtgcgctgttgcag
caaggtggaagcctgcttccgggcggcgtctgcgatgtctccggcgcattcgaacccggg
gcgcttgtgcgtatcgccgggccggacggaaccgtcattgccgtgggtttgtcgaattac
ggcgaccgtgaccttgtgcggataaaggggcatcgacgtcacgaagtggctgccattctt
ggtgatgcccatttcccggaagtggtgcaccgcgacaacatgcttctggacgccgtggta
tag

DBGET integrated database retrieval system