KEGG   Desulfovibrio vulgaris DP4: Dvul_2127Help
Entry
Dvul_2127         CDS       T00452                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00860  Porphyrin and chlorophyll metabolism
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
Module
dvl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dvul_2127
Enzymes [BR:dvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dvul_2127
Exosome [BR:dvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvul_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Glu_syn_central
Motif
Other DBs
NCBI-ProteinID: ABM29143
JGI: Dvul2127
UniProt: A0A0H3AA51
Position
2469603..2470595
Genome map
AA seq 330 aa AA seqDB search
MGDFFRGRRLRRTAALRELVRENVVCAADLIMPYFVVETDAPAFRKEIGAMPGQFQLSLQ
ELEKQVEAAVAKGLRAVILFGIPKVKDYKGSEAYNKDGIVQQAVRLLKKRWPALVVVTDV
CLCEYTDHGHCGLVRQGDTSGEVHNDPTLSLLTKAAVSHAEAGADIVAPSDMMDGRVQAI
RAGLDANGFSHIPVMSYAVKYASSFYGPFREAAESTPQFGDRKTYQMDPANSREAMREAA
ADVDEDADFLIVKPAGPYLDIIRQVRDNFDLPVVAYQVSGEYSMIRAAGINGWINEEAVI
MESLLGMKRAGCDLIITYFTEELLAKGLVR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggagacttcttcaggggccgtcggctacgtcgcacggcggccctgcgtgaactcgtc
cgcgagaacgtggtctgtgccgctgacctcatcatgccctatttcgtggtcgagaccgac
gcccccgcgttccgcaaggagataggggccatgcccggccagttccagctttcgttgcag
gaactggagaagcaggtcgaagcggccgtggcgaaggggctgcgtgccgtcatcctcttc
ggcatccccaaggtcaaggactacaagggcagcgaagcctacaacaaagacggcatcgtg
cagcaggcagttcgtctgctgaagaaacgctggcccgccctcgttgtcgtcaccgacgtc
tgcctgtgcgaatacaccgaccacggtcattgcgggcttgtgcgacagggagacacctcc
ggcgaagtgcacaacgaccccaccctgtcgctactgaccaaggccgccgtctcgcatgcc
gaagccggggccgacatcgtggcaccgtccgacatgatggacgggcgtgtgcaggccata
cgcgccggactcgacgccaacggattctcccacatcccggtcatgtcctatgcggtgaag
tatgcctcgtccttctacggcccgttccgcgaagccgcagaatcgacaccgcaattcggc
gaccgcaagacctaccagatggaccctgccaacagccgcgaagccatgcgcgaagccgct
gccgacgtggacgaggacgctgacttcctcatcgtcaaaccggcaggaccctacctcgac
atcatcagacaggtgcgcgacaacttcgacctgcctgttgtcgcctatcaggtgagcggt
gaatattccatgatccgtgcagccggtatcaacggctggatcaacgaagaggccgtgatc
atggagtcgcttctcggcatgaagcgtgcaggatgcgacctcatcatcacctacttcacc
gaagagcttctcgccaaagggctggtgcgctga

DBGET integrated database retrieval system