KEGG   Desulfovibrio vulgaris DP4: Dvul_2178Help
Entry
Dvul_2178         CDS       T00452                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dvl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dvl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2533448..2534758
Genome map
AA seq 436 aa AA seqDB search
MPCRILTLQSEAQWPLLGDMLAGRYDPDDAVEPVVRDILTAVRSKGDEALAEYTRRFDCP
DFTPALLHVTSEEVAQAVASVPADDIAIIRQAADNIRSFHEAQKERSWFVTHDDGTILGQ
KVTPVDRAGLYVPGGKGGDTPLLSSLLMNAIPAQVAGVTSITVASPPRPDGTLNPHLLAA
AHILGITDIIRAGSAWAVAAFAFGTQTIAPVDVIAGPGNIFVTTAKRMVQGRVAIDMIAG
PSEILILADATARPDWVAADMLSQAEHDPLASSILVTTEPALAEAVTAELERQLATLPRT
DIARNALADWGAVVVVPDMDVAVAIANRVAPEHLEVLTAQPWELAGSLRHAGALFLGPYS
PEPLGDYFAGPNHVLPTMGTARFSSALSVQTFCKRTSIIAASRAFAERNADAVARLARLE
GLEAHARSAASRNSQQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccctgccgcatcctcactctccagtcagaggcgcaatggcctcttctcggcgacatg
ctcgccggacgatacgaccccgatgacgccgtcgaacccgtcgtgcgcgacatcctcacc
gccgtccgcagcaagggtgacgaagccctcgccgagtatacccgccgcttcgactgtccc
gatttcacccccgccttactgcacgtcacctcagaagaggtggcgcaggccgtggcttcc
gtccctgccgacgacatcgccatcatcagacaggcagcggataacatccgcagcttccat
gaagcgcagaaggaacggtcgtggttcgtcacccatgatgacggcaccatcctcgggcag
aaggtcacgccggtcgaccgtgccggtctttatgtgcccggcggcaaaggaggcgacacg
cccctgctgtcaagtctgctgatgaacgccatccccgctcaggtggcaggcgtcacgagc
atcaccgtagcctcgcccccgcgtcccgacggcactctcaatccgcacctgctcgccgcc
gcccacattctgggcatcaccgacatcatccgggcggggagtgcatgggccgtggcggcc
ttcgccttcggcacacagaccatcgcgcccgtggatgtcatcgccgggccgggcaacatc
ttcgtcaccactgccaagcgcatggtacagggccgcgttgccatcgacatgatagcaggc
cccagcgagattctcatcctcgccgatgcgacggcgcgccccgactgggtcgccgccgac
atgctctcgcaggccgagcacgacccgctggcctcgtccatacttgtcaccacggaacca
gcactcgccgaagccgtcactgcggaactcgaacgccagcttgccacgcttccgcgcacc
gacatcgcccgcaatgcccttgccgactggggtgccgtggtcgtcgttccagacatggat
gtcgccgtggccatcgccaaccgcgtggccccggagcatcttgaggtgctcaccgcacag
ccatgggaacttgcggggagcctgcggcacgccggggcactctttcttggcccctattct
cccgagccactcggcgactacttcgccggccccaatcacgttctgcccaccatgggcacg
gcccgcttctcttcagcgctttcggtgcagacgttctgcaagcgcaccagcatcatcgcc
gcgtcacgtgcgttcgccgagcgtaacgccgacgcggtggcgcgccttgcgcgccttgaa
ggacttgaggcccacgcccgttcggcagcatcccgcaacagccaacagtaa

DBGET integrated database retrieval system