KEGG   Desulfovibrio vulgaris DP4: Dvul_2222Help
Entry
Dvul_2222         CDS       T00452                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dvl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dvl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dvl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dvl00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dvl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2576807..2578753
Genome map
AA seq 648 aa AA seqDB search
MASPAATLDALLREERVFRPLPRVVADAVVNPQDVARAREQAGTAPLAFWEEAAEELEWF
RRWDGVLDDSNAPFMRWFPGALCNIVHNALDRHIETSNRHRLALIWEGEPGDSRRFTYFD
LYREVNRLANAMRSLGVTKGDRVVIYMPPLPETVFAMLACAKIGAVHSTVFGGFSARSLC
DRVEDARPTLLLTVDGFYRNGRVVPLKPVADDAVDALSPEARAGLHHVVVVHRAHLETPM
RDGRDIWYHDLVRGQSTEALTEVLSANDPLFVLYTSGTTGKPKGLVHSHGGYMVGVHRTM
RWVFDVRPTDIFWCTAEPGWITGHSYGVYGPLMAGTTTVLYEGHPLYPEAGRLWSMVERW
GVTILYTVPTVIRMLMRFGPLYPARHDITTLRLLATVGEPISPETWVWFYRTIGRGRCPV
LDTWWQTETGMIMISPLPVSALKPGSVARPLPGVDVDIVDGEGAPVPPGRGGLLVVKNPW
PAMACGVFGDDEAFRRLYWERFPGWYCTGDVARRDDDGYIWIQGRADDVILIAGHRIGTA
EMEAALASHPAVAECAVIGVPDRLKGEVGKAFVVLRDTEEAAAEEQALATSLVGHVRREL
GPVAVIRDVVFREGLPRNRSGKIMRRILRSEEMGVETGDLSTLEDAYI
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcccgccgccactctcgatgcgctgctgcgtgaagagcgcgtgttccgccct
ctgccacgcgtcgtcgccgatgccgtggtcaaccctcaggacgtggcccgcgcacgcgaa
caggccggaacggcccctctcgccttctgggaagaggccgccgaagagctggaatggttc
cgccgctgggacggtgtgctcgatgacagcaacgccccgttcatgcgctggtttcccggt
gcgctgtgcaacatcgtccacaacgccctcgaccggcatatcgagacatccaaccgccac
cgccttgccctcatatgggaaggcgaaccgggtgacagccgtcgtttcacctatttcgac
ctctaccgtgaggtgaaccgcctcgccaatgccatgcgttccctcggcgtgacgaagggc
gacagggtggtcatctacatgcccccccttcccgagacggtcttcgccatgctcgcctgc
gccaagataggcgcggtacacagcacggtgttcggtggcttctcggcccgttcgctgtgc
gaccgcgtcgaagacgcaaggcccaccctgctgctgacggtggacggcttctaccgcaac
ggtcgcgtcgtaccgctcaagcccgtcgccgacgacgccgtggacgccctgtcaccggag
gcacgggccggtctgcatcatgtcgtggtcgtgcatcgcgcccacctcgagacccccatg
cgcgacgggcgcgacatctggtatcacgacctcgtgcgcggacagtccaccgaggcgctt
accgaagtcctctccgccaacgacccgctgttcgtcctctacacttccggcactaccggc
aagcccaaggggctggtgcacagtcacggcggctacatggtgggcgtacaccgcaccatg
cgctgggtcttcgacgtgcggcccaccgacatcttctggtgcaccgccgaaccgggctgg
ataacgggccatagctacggcgtgtacgggccgctcatggcgggcaccaccaccgtcctc
tacgaggggcaccccctgtaccccgaagcgggcaggctgtggtccatggtcgaacgatgg
ggtgtcaccatcctgtacaccgtccccacggtcatccgcatgctcatgcgattcggtccg
ctgtaccccgcgcgccacgacatcaccacgctacggcttctggctaccgtaggcgaaccc
atcagcccggagacatgggtgtggttctaccgcaccatagggcgagggcgctgcccggtg
ctcgacacatggtggcagacggagacgggcatgatcatgatcagcccgctgccggtgtcg
gccctcaaacccggttcggtggcccgtcccctgcccggtgtggatgtggatatcgtggac
ggggaaggtgcccccgtcccccccggcaggggtggactgctggtggtgaagaacccgtgg
cccgccatggcatgcggtgtcttcggtgacgacgaggccttccgcaggctttactgggag
cgctttcccggatggtactgcacgggtgacgtggcccgccgggatgacgacgggtacatc
tggatacagggacgtgccgacgacgtcattctcatcgccggacaccgtatcgggacggca
gagatggaagcggccctcgcgtcgcatcccgccgtggcggaatgcgccgtcatcggcgtg
cccgacaggctgaagggcgaagtgggcaaggcgttcgtcgttctgcgcgataccgaagag
gctgcggcagaagagcaggccctagccacgtcactggtggggcatgtccggcgtgaactc
ggcccggtggccgtcatacgcgatgtcgtattccgtgagggactgccacgcaaccgcagc
ggcaagatcatgcgccgtattcttcgttcggaagagatgggcgtggagacgggtgacctc
tcgacgctggaagacgcctatatctga

DBGET integrated database retrieval system