KEGG   Desulfovibrio vulgaris DP4: Dvul_2263Help
Entry
Dvul_2263         CDS       T00452                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00620  Pyruvate metabolism
dvl00630  Glyoxylate and dicarboxylate metabolism
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
dvl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dvul_2263
   00630 Glyoxylate and dicarboxylate metabolism
    Dvul_2263
Enzymes [BR:dvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dvul_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABM29279
JGI: Dvul2263
UniProt: A0A0H3A9C0
Position
complement(2633592..2635781)
Genome map
AA seq 729 aa AA seqDB search
MTGRIREGGLAVAEPLHRCIEREILPGTGISPSIFWAGLEELVGTLGPRNRELLARRDNM
QAAIDAWHKEHQGRPHDAAAYRRFLEDIRYLLPAPQDLAVETQGVDPEVATIAGPQLVVP
VTNPRYALNAVNARWGSLYDALYGSDVIADSDGAARGAAYNPLRGEKVVAYAAAFLDRTF
PLAGARHADVVRYELTGPPVGRKLSALCADGTVTGLLHPDAFAGYTGGERPTTVLLRNNG
LHVELQFDRRHPVGAAHPAGLKDVVLESAVTTILDCEDSVATVDAEDKALAYRNLLGLFR
GDLETSFDKGGRSVFRRLAADRTYTAPGGAAYALPGRSLMLVRNVGLLMTTDAVLDAAGQ
EIPEGILDGLVTACIGLHDLRGAGRHRNSGAGSVYIVKPKLHGPEEVAFVCEQFRRIEDI
LGMARNTLKMGVMDEERRTTLNLAECIRVASQRIIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAQRWMLAYEDWNVDTGLAAGFGGKAQIGKGMWPKPDRLAEMVATKGAHPRAGANC
AWVPSPTAATLHALHYHEVDVFARQRELAGCHRASLDDLLALPLMGEARPSPAEVREELE
NNAQSILGYVVRWVEMGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGICTEDEVR
DVMLRMATVVDRQNKDEPGYRPMSADPGSSVAFRAACDLVFEGARQPNGYTEPILHARRR
EVKARSLTR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacgcatacgtgaaggcggcctcgctgtggccgaacccctgcaccgttgtatc
gaacgcgagattctgccgggcaccggcatctccccctccatcttctgggcggggctggaa
gagcttgtcggcaccctcggcccccgtaaccgcgaattgctggcccgacgggacaacatg
caggcggcgatagacgcatggcacaaggagcatcaggggcggccgcacgatgccgcagcc
tacaggcgttttctcgaagacatccgttatctgcttcccgcaccgcaggacctcgcggtt
gaaacgcagggggtcgaccccgaagtggcgaccatcgccgggccgcaacttgtcgtgccc
gtgaccaacccccgctatgccctcaatgccgtcaacgcccgctggggcagcctctacgac
gccctgtacggcagcgacgtgattgccgacagcgacggggctgcacgtggcgctgcctac
aatcccctgcggggcgagaaggtggtggcgtatgccgccgcgttccttgacaggacattc
ccgttggccggggcgaggcatgccgacgtggtgcgctacgagttgaccgggccaccggtg
ggtcgcaagctgtcggccctttgtgccgacggtacggtgacgggcctgctgcatcctgat
gcgttcgccggctatacggggggagagcgcccgacgacggtgctgctgcgcaacaacggg
ctgcatgtcgaattgcagttcgaccgcaggcacccggtgggggctgcccaccctgcggga
ctcaaggatgtggtgctcgagtcggcggtgaccaccatcctcgattgcgaggattccgtg
gccaccgtcgatgccgaagacaaggccctcgcctatcgcaatctgcttggactgttccgg
ggcgaccttgagacctcgttcgacaagggcgggcgcagcgtcttcaggcgtctggcagca
gacaggacgtacaccgcaccgggcggggcagcgtatgccctgccggggcgcagcctgatg
ctggtgcgtaacgtggggctgctcatgaccaccgacgccgtgctcgacgcggcagggcag
gagattcctgaaggcatcctagacgggctcgtcaccgcctgcatcgggctgcacgacctg
cgcggtgcggggcgtcatcgcaacagcggagctggcagcgtgtacatcgtcaaacccaag
ctgcatggccccgaagaggtggcgttcgtctgcgagcagttcagacgcatcgaagacatc
ctcggcatggcgcgcaataccctcaagatgggggtgatggacgaggaacggcgaaccacg
ctcaatcttgcggagtgcatacgggtggcttcgcagcgtatcatcttcatcaatactggc
ttcctcgaccgtacgggcgacgagatacacacctgcatggaggcggggcccgtcgtgcgc
aagaacgacatgaaggcccagcgctggatgctcgcctatgaggactggaacgtggacacc
gggcttgccgccggtttcggcggaaaggcccagataggcaagggcatgtggcccaagccc
gacaggctggcggagatggtcgccaccaagggggcgcacccgcgtgccggggccaactgc
gcgtgggttccctctccaacggcggcgacactgcacgccctgcactaccatgaggtggat
gtcttcgcgcgtcagcgcgaacttgccggatgtcaccgggcgtcgctggacgaccttttg
gctttgccgctcatgggtgaggcgcgtccctcgcccgctgaagtgcgcgaagaactggag
aacaacgcccagagcatcctcggctacgtggtacggtgggtcgagatggggataggctgc
tcgaaagtgcccgatatccatgacgtgggtctcatggaagacagggccaccctgcgtatc
tccagccagcacatcgccaactggttgcgccatggcatctgcacggaggacgaggtgcgt
gacgtcatgctacggatggcgaccgtggtcgacaggcagaacaaggatgaaccgggctac
cggcccatgtctgccgaccccggttccagcgtggcgttcagagcggcatgcgacctcgtg
ttcgagggggcgcgccagcccaacgggtataccgaacccatcctccatgcccgcaggcgc
gaggtgaaggcgcgtagtctcacccggtag

DBGET integrated database retrieval system