KEGG   Desulfovibrio vulgaris DP4: Dvul_2276Help
Entry
Dvul_2276         CDS       T00452                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dvl01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dvl00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2651540..2653303)
Genome map
AA seq 587 aa AA seqDB search
MPIEGTASRVLHVDLESGASRVLLFEGRPHHLGGSGLAAALYDAYGLPESPASDPRQPLI
FAIGPLSGFFPLMSKVVCGFRSPYTGEWAESHAGGRLALSLRFAGYDALMITGRARTLSC
LVVGSRRLEIHDVHYLRGQDVFTSGKYLRRYGKESSGHRSTVRIGPAGERGVTFACANVD
SFRHFGRLGAGAVMGGKNLKALVVTGDSGIELPEGRDYPKLYKEVYQSVTGTDMMQKYHD
LGTAENLLVLNELKALPWRNLQATTDPAIDGISGERFAEQLLLRQTACAGCPVGCIHIGL
LRQQFARDHEFLYKQVSYDYEPIFAQGSMLGLTNASDVLALLDETEKLGLDCMSAGVALA
WVAEAFEKGVVTEKETLGPVHFGNVATFVAALHHLANGTSEFWQALGKGVLYAADIYGGA
DFACVLGQEMAGYATGEVYFVSQALGFRHSHLDSGGYAYDQSAKDKDVDKAVRHLLDDEY
KRLTINCMVACLFARKAYPPERLQEALASLGMRAEADALPESGRAMQALRWSLKFRTGFR
PENVRIPKRFTEVVTWKGPMDVDYMDAVRQAYTSELYRMVVDAAREA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgaaggaaccgcctcgcgcgtgctgcatgtggaccttgagtcgggtgcctcg
cgtgtgctgcttttcgagggacgccctcaccatctcggcggcagcgggcttgccgctgca
ctgtatgacgcctacgggttgccggaatctccggcttccgacccgcggcagccgctcatc
ttcgccatcggaccgctttcggggttctttcccctcatgagcaaggtcgtgtgcggcttc
cgttcaccgtacacgggagaatgggccgagagtcacgcgggggggcgccttgccctgtcg
ctgcgcttcgcgggatatgacgcgctgatgatcaccggacgggcgcgaacgctctcatgt
cttgtcgtggggtcgcgtcgtctcgaaatccacgatgtccactacctgcgcggacaggac
gtgttcacttccgggaagtatctgcgccgctatggcaaggagtcgtcagggcatcgtagc
acggtgcgcatcgggcctgcgggcgagcgtggtgtcaccttcgcgtgcgccaacgtcgac
tcgttccggcatttcggacgactgggcgcaggtgccgtcatgggcggcaagaatctcaag
gcgctggtcgtgacgggcgactcgggcatcgaactgcctgaagggcgcgactatccgaaa
ctctacaaggaagtgtaccagtcggtcaccggtaccgacatgatgcagaagtaccacgac
ctcggcactgccgagaacctgctggtgctcaatgaactgaaggcgttgccgtggcgcaac
ctgcaagccacgacagaccccgccatcgacggcatctctggcgaacggttcgcagaacag
cttctgctgcggcagaccgcctgcgcgggctgtccggtggggtgcatccacatcgggttg
ctgcgacagcagttcgcccgcgaccacgagttcctctacaagcaggtgtcatacgactac
gaacccatcttcgcgcagggttccatgctgggcctgaccaacgcctccgacgtgcttgcc
ctgctcgatgagacggagaaactcggccttgactgcatgagcgccggtgttgcactggca
tgggtggcggaggcgttcgaaaagggtgtcgtcaccgagaaggagacgctgggcccggtg
cacttcggcaacgtggccacgttcgtcgccgcgctgcaccaccttgccaacggaacctcc
gaattctggcaggcgttgggcaagggggtgctgtatgccgcagacatctacggcggtgcc
gacttcgcctgtgtcctcggtcaggagatggcaggctatgccacgggcgaggtgtatttc
gtctcacaggccctggggttcaggcattcgcatctcgacagcggcggctatgcctacgac
cagtccgccaaggacaaggacgtggacaaggccgtgcggcatctgctggatgacgagtac
aaaaggctgaccatcaactgcatggtggcctgtctcttcgcccgcaaggcctacccgccg
gaacgccttcaggaggcccttgcctctctcggcatgcgcgccgaggccgatgccctgccc
gagtcggggcgtgccatgcaggccctgcggtggtcgctcaagttccgcacggggttccgt
ccggagaacgtgcgtatccccaaacggttcaccgaggtcgtcacatggaagggccccatg
gacgtcgactacatggatgccgtgcgacaggcctacacgtccgagttgtaccgcatggtg
gtggacgccgcacgggaggcatag

DBGET integrated database retrieval system