KEGG   Desulfovibrio vulgaris DP4: Dvul_2278Help
Entry
Dvul_2278         CDS       T00452                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00010  Glycolysis / Gluconeogenesis
dvl00030  Pentose phosphate pathway
dvl00051  Fructose and mannose metabolism
dvl00052  Galactose metabolism
dvl00230  Purine metabolism
dvl00500  Starch and sucrose metabolism
dvl00520  Amino sugar and nucleotide sugar metabolism
dvl00521  Streptomycin biosynthesis
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01120  Microbial metabolism in diverse environments
dvl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvul_2278
   00030 Pentose phosphate pathway
    Dvul_2278
   00051 Fructose and mannose metabolism
    Dvul_2278
   00052 Galactose metabolism
    Dvul_2278
   00500 Starch and sucrose metabolism
    Dvul_2278
   00520 Amino sugar and nucleotide sugar metabolism
    Dvul_2278
  Nucleotide metabolism
   00230 Purine metabolism
    Dvul_2278
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dvul_2278
Enzymes [BR:dvl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dvul_2278
    5.4.2.8  phosphomannomutase
     Dvul_2278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ABM29294
JGI: Dvul2278
UniProt: A0A0H3AAH8
Position
complement(2653865..2655226)
Genome map
AA seq 453 aa AA seqDB search
MKALSAHVFRAYDIRGIVDTDFDPEWVERLGRACGTYFVSHGHGAAVVGFDCRHSSPAYH
DALVRGLLSTGVDVTSVGMVPTPVLYFAVKHLGRKAGVMITASHNPSEYNGFKVVAGEST
IHGEEIRRIWEIFERGEFASGHGIGCSHDIVPSYIEAITSDVHPARKLKVVVDGGNGAGG
ELCVEVLRRLGVEVVAQFCEPDGDFPNHHPDPVVEANMTALMERVQVERADLGIGLDGDA
DRLGAVDGRGRLLNGDELLSLYAREMLARRPGETVIADVKCSHRLFDDIEAHGGKPMMWI
TGHSVVKARMLEVGAPLAGELSGHMFFGDRWFGFDDAIYGAARLVELLAASDVPLTDLPG
WPPSHATRELHLPCPEHAKFEVVRRAQAYFRERCTINDIDGARVIFPDGWGLVRASNTQP
VLVLRFEAQTPERLAEIRAFVEEPLRRWVAELS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttatcggcccatgtgttcagggcctacgatatcagagggattgtcgacacc
gatttcgacccggaatgggtcgagagactcggaagggcctgcggaacctactttgtctcg
cacggtcacggggctgccgttgtggggttcgattgccgccacagttcgccagcctaccac
gacgcactcgtgcgcggcctgctgtcgacgggggtggatgtgaccagcgtgggcatggtg
cccaccccggtattgtatttcgccgtgaaacacctcgggcgcaaggccggggtcatgatc
acggcaagccacaatccatcggaatacaacgggttcaaggtcgtcgccggagagtcgacc
atccacggcgaggagattcgccgcatatgggagatcttcgagcgtggcgagttcgcttcg
gggcacggcatcgggtgttcccatgacatcgtgccctcctacatcgaagccatcacctct
gatgtgcaccccgcgcgcaagctgaaggtcgttgtcgacggaggcaacggtgctggcggc
gagctttgcgtcgaagtgctgcgcaggctgggtgtggaggtcgtggcgcaattctgcgaa
cccgatggcgacttccccaaccatcaccccgaccccgtggtcgaggccaacatgaccgcg
ctcatggaacgcgtgcaggtcgaacgcgcagacctcggcatcggtctcgacggcgatgcc
gacaggcttggtgccgtagacgggagggggcggctgctgaacggtgacgaactgctctcg
ctctatgcgcgcgagatgctggcccgtagaccgggcgagacggtcatcgccgacgtcaaa
tgctcgcatcgccttttcgacgacatcgaggcgcacggcggcaagcccatgatgtggatc
acagggcactccgtggtcaaggcgcgtatgctcgaagtcggcgcaccgctggcgggtgag
ctttcggggcacatgttcttcggcgacagatggttcggcttcgacgacgccatctacggg
gctgcccgtctcgtggaactgctcgcagccagtgacgtgcccctgaccgacctgcccggc
tggccgccaagccacgcgacccgcgaattgcacctgccctgtccggagcacgccaagttc
gaagtcgtgcggagggcacaggcctatttccgtgagcgatgcaccatcaacgacatcgac
ggtgcgcgtgtgatctttcccgatggatggggccttgtgcgtgcctccaacacccagccg
gtgctcgtgttgcgtttcgaggcgcagacgccggaacgtctggccgagattcgcgccttc
gtcgaagaaccgttgcgacgctgggtcgcggaactttcatag

DBGET integrated database retrieval system