KEGG   Desulfovibrio vulgaris DP4: Dvul_2466Help
Entry
Dvul_2466         CDS       T00452                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dvul_2466
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dvul_2466
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dvul_2466
Enzymes [BR:dvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dvul_2466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2872027..2872800)
Genome map
AA seq 257 aa AA seqDB search
MSASRLERRIREAQAAGRPALIPFLTAGFPTPERFWDELEALDAAGADIIEVGVPFSDPV
ADGPVVAAASQRALESGVTLRWIMDGLAARKARLRAGLVLMGYLNPFMQYGFERFVTDAA
DAGVAGCIIPDLPLDEDADLRALLAARGMDLIALVGPNTGEGRMREYAAVASGYVYVVSV
MGTTGVRDGLPVEVADTLARARQCFSIPVALGFGISRPAQLEGLSHPPDAVIFGSALLRH
LDAGGDAASFMKAWAER
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtcacgtcttgaacggcgcattcgcgaggcacaggcggcggggcgtcccgcc
ctcatcccctttctgacggcgggttttcctacgcccgaacggttctgggacgaactcgag
gccctcgacgcggcaggggccgacatcatcgaagtgggcgtgcccttctccgaccccgtg
gcggacggcccggttgtggcagccgcctcgcagcgggcgctggagtccggtgtgacgctg
cgctggatcatggacgggctggcggcccgcaaggcgaggctgcgcgccggacttgtgctg
atggggtacctcaacccgttcatgcagtacggcttcgagcgtttcgtgaccgatgcggcc
gatgcgggcgtggcggggtgcatcatccccgacctgccactggatgaggacgccgacctg
cgggcactgcttgccgcgcggggcatggacctcatagcgctggtggggcccaacacgggc
gaagggcgtatgcgcgagtatgccgccgtcgcctcgggctacgtctatgtggtgtcggtc
atgggcaccacgggcgtgcgggacggcctgcccgtggaggtggcggacacgctggcgcgg
gcacgtcagtgcttctccatccccgtggcgctcggtttcggcatcagccgtccagcgcaa
ctggaggggctgtcacatccgcccgacgccgtcatcttcggttctgccctgttgcgtcat
ctcgacgcgggcggcgacgccgcttcgttcatgaaggcgtgggcggagagataa

DBGET integrated database retrieval system