KEGG   Desulfovibrio vulgaris DP4: Dvul_2467Help
Entry
Dvul_2467         CDS       T00452                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dvul_2467
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dvul_2467
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dvul_2467
Enzymes [BR:dvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dvul_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2872797..2873984)
Genome map
AA seq 395 aa AA seqDB search
MKKGYFGDFGGRFVPELLMPPLMEIEAAMRDIMPTQAFRHELDDLLHNFAGRETPLTRCD
TLSRELGCTLWLKREDLLHTGAHKVNNTLGQALLARSMGKTRLVAETGAGQHGVATAAAA
ARLGLSCIVFMGAVDVERQSANVMRMKLLGAEVVPVESGTRTLKDAINEALRYWIAEQGS
THYCFGTAAGPHPFPTLVRDFQAVIGHETRRQMLERTGALPDMVVACVGGGSNAIGMFHA
FVEDADVRIVGVEAAGTGEPGCYNSAPINLGSPGVLHGNRTMLLQDGDGQILPSHSVSAG
LDYPGVGPEHAHLGATGRVVYGMVTDTQALAAFKALTRAEGIIPALESSHAVAWVLENPH
LLPQGGNVVVNLSGRGDKDMDIVREHLFPGLGGKA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggctatttcggcgatttcggcggcaggttcgtgcctgaactgctgatgccg
cccctgatggagattgaggcggccatgcgcgacatcatgcccacgcaggcattccgccat
gagcttgacgacctgctgcacaacttcgcagggcgtgagacccccctcacccggtgcgac
accctgtcgcgtgaactcggctgcaccctgtggctgaaacgtgaagacctgctgcacacc
ggggcgcacaaggtgaacaacaccctcgggcaggcgttgctggcccgaagcatgggcaag
acgcgtctcgtggcggagaccggcgcggggcagcatggcgtggccaccgcagcggcggcg
gcacggcttggcctttcgtgcatcgtcttcatgggggcggtggatgtggaacgccagtcc
gccaacgtcatgcgcatgaagctgctgggggcggaggtcgtgcccgtggaaagcggcaca
cgcaccctcaaggacgccatcaacgaggccctgcgctactggatagcggaacagggcagt
acgcactactgcttcggcacggcggcggggccgcaccccttccccacgctggtgcgcgac
tttcaggctgtcatcggccacgagacccggcggcagatgctggaacgcacgggtgcgcta
cccgacatggtggtggcgtgcgtgggcggcggttccaatgccatcggcatgttccacgcc
ttcgtagaggatgccgatgtgcgcatcgtgggtgtcgaagccgcaggtacgggcgaaccg
gggtgctacaactccgcgcccatcaacctcgggtcgccgggggtgctgcatggcaaccgc
accatgctgctacaggacggcgacggacagatactgccgtcgcattccgtctcggcggga
ctcgactaccccggcgtggggccggaacatgcccacctcggtgccacggggcgcgttgtc
tacggcatggtcaccgacacgcaggcgctagccgcattcaaggcactcacccgtgccgag
ggcatcatccccgcgctggaatcgtcgcacgcggtggcatgggtgcttgagaacccgcac
ctgctgccgcagggcggcaatgtggtggtgaacctttcgggacgtggcgacaaggatatg
gacatcgtgcgggaacacctgttccccggtctgggaggcaaggcatga

DBGET integrated database retrieval system