KEGG   Desulfovibrio vulgaris DP4: Dvul_2876Help
Entry
Dvul_2876         CDS       T00452                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
dvl00260  Glycine, serine and threonine metabolism
dvl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dvl01100  Metabolic pathways
dvl01110  Biosynthesis of secondary metabolites
dvl01130  Biosynthesis of antibiotics
dvl01230  Biosynthesis of amino acids
Module
dvl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dvul_2876
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dvul_2876
Enzymes [BR:dvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dvul_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABM29887
JGI: Dvul2876
UniProt: A0A0H3AB65
Position
complement(3360782..3362026)
Genome map
AA seq 414 aa AA seqDB search
MTATATTLHRPDTSTGFFGAYGGQFVPDQLKPILDDLAATFDACKDDPSFIEEFTYYLTR
YSGRATPLFLCSNLTERLGGARIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKVIAET
GAGQHGVATAATAALMGMQCTIYMGAEDMERQKLNVFRMRMMGAEVVPAMSGQRTLKEAV
DEALAAWVQDANETFYLLGSAVGPHPYPAIVRHFQSVIGREARAQILEAEGRLPDCCIAC
VGGGSNAIGLFAEFVPDTSVRLIGVEPAGRGLTYGDHAATLCLGEPGVLHGFYSYMLKDD
KGEAAAVYSISAGLDYPGVGPEHSHLKDMNRAEYVSVTDVEAVDAFFTLSRAEGIIPALE
SSHALAHAMKMAPAMPKDAIIVVNLSGRGDKDVAQIEEMVSNGLVTPPAMVRGL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctaccgccaccacccttcatcgtcccgacacctccaccggcttcttcggcgcg
tatggcgggcagttcgtgcccgaccagctcaagcccatcctcgacgacctcgctgccacc
ttcgacgcctgcaaggacgacccttcgttcatcgaagagttcacctactacctcacccgg
tattccgggcgggcgacgcctctcttcctgtgctccaatctgaccgaacggctcgggggg
gcgcgtatctatctcaagcgcgaagacctcaatcacctcggcgcccacaaggtgaacaac
accatcggccagattctgcttgccaaacgcatgggcaagaagaaggtcatcgccgagacc
ggggccgggcagcatggcgttgccacggctgccaccgcggcgctcatggggatgcagtgc
accatctacatgggggctgaggacatggagcgccagaagctcaacgtcttcaggatgcgc
atgatgggggcggaggtcgtgcccgccatgagcggtcagcgcaccctcaaggaagcggtg
gacgaggccctcgccgcatgggtgcaggacgccaacgagacgttctacctcttgggttca
gcggtggggccgcatccataccccgccatcgtgcgtcatttccagtcggtcatcggtcgt
gaggcgcgtgcccagatacttgaggccgaaggacgcctgcccgattgctgcatcgcgtgc
gtgggtggtgggtccaacgccatcggtcttttcgcggagttcgtgccggatacgtcggtg
cgtctcatcggtgtcgaacctgccggacgcggtctcacctacggcgaccatgccgcaacc
ctgtgccttggtgaacccggcgtcctgcatgggttctattcctacatgctcaaggacgac
aagggtgaggccgctgccgtgtattccatctcggcagggctggactaccccggtgtcggg
cctgaacacagccacctcaaggacatgaaccgggccgaatacgtcagtgtgacagacgtg
gaggctgttgatgccttcttcaccctgtcgcgtgccgagggcatcatccccgcgctggaa
tcgtcccatgctctcgcccatgccatgaagatggcgcctgccatgccgaaggacgctatc
atcgttgtgaatctctccgggcgcggcgacaaggacgtggcacagatagaggagatggtg
tcgaacgggcttgtgacaccccctgccatggtgcgtgggctgtaa

DBGET integrated database retrieval system