KEGG   Desulfovibrio vulgaris DP4: Dvul_2887Help
Entry
Dvul_2887         CDS       T00452                                 

Definition
polysaccharide biosynthesis domain-containing protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:dvl00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dvl00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3374758..3375201)
Genome map
AA seq 147 aa AA seqDB search
MDGIAGVETQDLRIIPTDGGPVLHMLRPDAPLFMGFGELYFSEVLPGAVKAWKRHTRQTQ
HFAVPVGRLKVVVYDDREGSPTRGRVEEHILGRPDAYRLLRIPPLVWYGFTAVGDVPALI
CNCADIPHDPQEGERKDRDSADIPYHW
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggacggcatagccggggtcgagacgcaagacctgcgtatcatccccaccgacggcggg
ccggtgctgcacatgctgcggcccgacgcgcccctgttcatgggcttcggcgagttgtac
ttctccgaggtgctgcccggcgcggtgaaggcgtggaagcgccatacccgccagacccag
catttcgccgtgccggtgggacgcctcaaggtcgtcgtctacgacgaccgcgaagggtcg
cccacccgcgggcgcgtggaggaacacatcctcggacgacccgatgcctaccgcctgctg
cgcattccgccgctggtgtggtatggcttcaccgccgtgggtgatgtgcccgcgctcata
tgcaattgcgccgacatcccgcacgacccgcaggagggcgagcgcaaggacagggattcc
gccgacatcccgtaccactggtag

DBGET integrated database retrieval system