KEGG   Desulfovibrio vulgaris DP4: Dvul_3035Help
Entry
Dvul_3035         CDS       T00452                                 

Definition
asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dvl  Desulfovibrio vulgaris DP4
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dvul_3035
Enzymes [BR:dvl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dvul_3035
Peptidases [BR:dvl01002]
 Cysteine Peptidases
  Family C44
   Dvul_3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pDVUL01:103348..105996
Genome map
AA seq 882 aa AA seqDB search
MCGIAGIISRKDRNVSSQPLNRMLTSQEHRGPDAGYGVSFRRQSTGAFAAGQRHAADALA
AGLEPAPVWLGHRRLSILDLSDKSAQPLRRGDLHIVFNGELFNYIELRSELTALGEHFET
SGDTEVLLASYRHWGAGCLERFNGIFAFAIFDASRGSLFAARDPFGVKPFHYAVTHDFLI
FASEIKAISASGLVLRKWDPDVASAYLSYALTTAPQGRTFFENIRQIPPGHCLTLASPDD
EPSVTRYYAPRITETPRSLHELVDEGAGLIRQSCRIRMRSDRDVGLCLSSGIDSANVAAA
LVAEGIAPECYSIDAASSSMLDEFPLITALADKLGLHVNPIRHPDAIPTADIVRYMLFND
EPSLFWGSYNQFHLYREMRKLGVIVSMSGHGGDELFCGYQRYYPAVVRDMLAQRRIVSLI
WWCLRQSRHLMQDRRTIRSTWDSYSHPLGWANDYAHDIAALHLKHTIADPEEWISTFVGA
SSWGEQQQKSLFTYELQYLLRDADRNSMAHGIEERVPLLDTRLYEFCASVPLKDLCQDGY
LKGLARQLFPAIPESLRFHQIKRGLYTDISSKLPQLQADLMPLVHRSPLLRELVDLQKLP
QQLPGIVWWRLCSLAVLDVSGIEEWTAQTPLHRLVDDEMAERIGGVPSGTGRTAVIRHVL
DEGLSYLEPGALHGLAETVGLIESAAIPGCIIEAGCALGGSTMVLATAKAKERPLHVFDV
FGCIPPPGSNDGEEARARFAVIAAGESTGLNGKRYYGYEPDLLKNVQDNFVALGLPPAEH
GITFVPGLYENTLYPSGPVALAHIDCDWYQSVKTCLERIAPHISPGGRMIIDDYDHYSGC
RRAVDEFLEASNGQFIRERYARVHLVRTKADGQETDVHRPGD
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattgcaggcatcatatctcgcaaagacagaaacgtatcgagccagcccctg
aacaggatgctcaccagtcaggagcatcgtgggcctgacgccggttacggtgtatccttt
cggcggcagtcgaccggggccttcgcggcaggacaacgccacgcggctgacgccctcgca
gccggcttggaacccgcgccggtctggcttggccacagaaggctgtccattctcgacctc
tccgacaagtcggcccagccgctacgccggggggacctgcatatcgtcttcaatggtgag
ctcttcaactatatcgaacttcgaagtgaactgaccgcactcggcgagcacttcgagacc
tccggagacaccgaggtgcttcttgcgtcctaccgccactggggcgcaggatgccttgaa
cggttcaacggcatattcgccttcgccatcttcgatgccagccggggcagtcttttcgcc
gcacgcgacccgttcggcgtcaagccgttccactacgccgtcacgcacgatttcctcatc
ttcgcctcggagatcaaggccatatccgccagcggactggtgctgcgaaagtgggacccg
gacgtggcctccgcctatctttcctatgcgctgacgactgccccgcagggacggaccttc
ttcgagaacatcaggcaaatcccgcccggtcactgcctcacgctcgccagccccgacgat
gagccgtcggtgacacgctattacgcgcccagaatcacggagacaccgcgtagccttcac
gaactcgtcgacgaaggggcggggctcattcgccagtcatgccgcatacggatgcgcagc
gaccgtgatgtcgggctgtgtctcagttcgggcatcgattccgccaacgtggcggctgcc
cttgtcgcggaaggcatcgcccctgagtgctattccatcgacgctgccagttcttcaatg
ctcgacgaatttccgctcatcacggcgctggctgacaaactggggcttcatgtcaacccc
atacggcatcccgacgccattcccacggccgacatcgtccgctacatgctgttcaacgac
gagccttcgctcttctgggggtcgtacaaccagttccatctgtatcgtgaaatgcgcaag
ctgggtgtcatcgtgtccatgagcggacacggtggcgacgaactgttctgcggctatcaa
cggtactatccggctgtcgttcgcgacatgctcgcacagagacgaatcgtgtctctcatc
tggtggtgtctgcgtcagtcaaggcatctcatgcaggacagacgcaccatcagaagcaca
tgggacagctacagccacccgctaggctgggcaaacgactacgcacacgacatcgcagcc
ctgcacctgaagcacaccatcgccgaccctgaagaatggatttcgacattcgtcggcgcc
tcttcgtggggggagcaacagcagaaatccctgttcacatatgaactgcaatacctgctg
cgggacgccgaccggaactccatggcccacggcattgaagaacgggttcccctgctggat
acgcggctgtacgagttctgtgccagcgtcccgctgaaggacctgtgtcaggacgggtac
cttaagggactcgcacggcagctgttccccgccatccctgaatcattgcggtttcaccag
ataaaacgggggctttacacggacatcagctccaagctgccacagttgcaggcagacctc
atgccccttgtgcaccgaagccccctgctgcgtgagcttgtcgacctgcagaaactcccg
cagcagcttcccggcatcgtctggtggcggctttgcagccttgccgtgctggatgtgagc
ggaatcgaggaatggacggcgcagacccccttgcaccgactcgtcgacgacgagatggca
gagcgcatcgggggggtgccctccggcactggcaggaccgccgtcatcaggcatgtgctc
gacgaggggctttcgtatctcgaaccgggagccctgcacgggctcgccgagaccgtagga
ctcatcgaatcggcggcaatcccgggctgtatcatcgaagccgggtgtgccctcggcggg
tcgaccatggtccttgccacggccaaggctaaagagcgaccgttgcatgtcttcgatgtc
ttcgggtgcatcccgccccccggcagcaacgatggcgaagaggcacgtgcccgttttgcg
gtcattgccgccggagagtccacggggctcaacggcaagcgctattacggctacgaacct
gacctgctcaagaatgtgcaggacaacttcgtcgctctcggactgccccctgccgaacat
ggcataaccttcgtccccggcctctacgagaacaccctctacccttccgggccggtggcg
ctggctcacatagattgcgactggtaccagtcggtgaagacctgccttgagcgtatcgcc
ccccacatctcaccggggggccgcatgatcatcgacgactatgaccactacagcggatgc
cgcagggcggttgacgaattccttgaagcctcgaacggacaattcatccgcgaacggtac
gcccgggttcacctcgtccgcaccaaggctgacggacaggagacggacgtacaccggccc
ggcgactag

DBGET integrated database retrieval system