KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0060Help
Entry
DvMF_0060         CDS       T00816                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DvMF_0060
   00052 Galactose metabolism
    DvMF_0060
   00500 Starch and sucrose metabolism
    DvMF_0060
   00520 Amino sugar and nucleotide sugar metabolism
    DvMF_0060
Enzymes [BR:dvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DvMF_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
78141..79016
Genome map
AA seq 291 aa AA seqDB search
MNIRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAMRSGIGDVVFVTNRDK
KIIEDHFDYNLQLEGVLERAGKTEMLRQVREVAEMVNIISIRQKQQLGLGHAVLCARDVV
RDESFAVMVGDDLMFGMTPGIKQLIDVAASERLPVIGVMEVPADKVNRYGIISGEEFAPG
IFKVNKLVEKPKLGEAPSRLAIVGRYVLTPDIFRCLEQMKPGHGGEIQLTDALQMLADDR
GLLAVKIRGMRFDAGDWAEYLTANIYFALQDEELRDELVRQLKPLLPYSGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgcaaggtcgtcattcccgtcgccggctggggtacccgttcgcttcccgcc
accaagaacatcccgaaggaaatgctgccggtctacaacaagccggtggtgcagtatgtg
gtcgaagaggccatgcgctcgggcatcggcgacgtggtcttcgtcaccaaccgcgacaag
aagatcatcgaggaccacttcgactacaacctgcagctggaaggcgtgctggagcgcgcc
ggaaagaccgagatgctgcggcaggtgcgcgaggtggccgagatggtcaacatcatctcc
atccgccagaagcagcagctgggccttggccacgcggtgctgtgcgcccgcgacgtggtg
cgcgacgaatccttcgccgtcatggtgggcgacgacctgatgttcggcatgacgccgggc
atcaagcagctcatcgacgttgccgcctccgagcggctgcccgtcatcggggtgatggaa
gtgcccgccgacaaggtgaaccgctacggcatcatctccggcgaggaattcgcccccggc
atcttcaaggtcaacaagctggtggaaaagcccaagctgggcgaggcgccttcgcgcctg
gccatcgtgggccgctacgtgctgaccccggacatcttccgctgcctcgagcagatgaag
cccggccacggcggggagatccagcttaccgacgccctgcagatgctggccgacgaccgg
ggcctgctggccgtgaagattcgcggcatgcgcttcgatgcgggcgactgggcggaatac
cttaccgccaacatctacttcgccttgcaggacgaagagctgcgcgacgaactggtgcgt
cagctcaagccgctgctgccgtacagcggcacgtag

DBGET integrated database retrieval system