KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0060Help
Entry
DvMF_0060         CDS       T00816                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DvMF_0060
   00052 Galactose metabolism
    DvMF_0060
   00500 Starch and sucrose metabolism
    DvMF_0060
   00520 Amino sugar and nucleotide sugar metabolism
    DvMF_0060
Enzymes [BR:dvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DvMF_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
78141..79016
Genome map
AA seq 291 aa AA seqDB search
MNIRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAMRSGIGDVVFVTNRDK
KIIEDHFDYNLQLEGVLERAGKTEMLRQVREVAEMVNIISIRQKQQLGLGHAVLCARDVV
RDESFAVMVGDDLMFGMTPGIKQLIDVAASERLPVIGVMEVPADKVNRYGIISGEEFAPG
IFKVNKLVEKPKLGEAPSRLAIVGRYVLTPDIFRCLEQMKPGHGGEIQLTDALQMLADDR
GLLAVKIRGMRFDAGDWAEYLTANIYFALQDEELRDELVRQLKPLLPYSGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgcaaggtcgtcattcccgtcgccggctggggtacccgttcgcttcccgcc
accaagaacatcccgaaggaaatgctgccggtctacaacaagccggtggtgcagtatgtg
gtcgaagaggccatgcgctcgggcatcggcgacgtggtcttcgtcaccaaccgcgacaag
aagatcatcgaggaccacttcgactacaacctgcagctggaaggcgtgctggagcgcgcc
ggaaagaccgagatgctgcggcaggtgcgcgaggtggccgagatggtcaacatcatctcc
atccgccagaagcagcagctgggccttggccacgcggtgctgtgcgcccgcgacgtggtg
cgcgacgaatccttcgccgtcatggtgggcgacgacctgatgttcggcatgacgccgggc
atcaagcagctcatcgacgttgccgcctccgagcggctgcccgtcatcggggtgatggaa
gtgcccgccgacaaggtgaaccgctacggcatcatctccggcgaggaattcgcccccggc
atcttcaaggtcaacaagctggtggaaaagcccaagctgggcgaggcgccttcgcgcctg
gccatcgtgggccgctacgtgctgaccccggacatcttccgctgcctcgagcagatgaag
cccggccacggcggggagatccagcttaccgacgccctgcagatgctggccgacgaccgg
ggcctgctggccgtgaagattcgcggcatgcgcttcgatgcgggcgactgggcggaatac
cttaccgccaacatctacttcgccttgcaggacgaagagctgcgcgacgaactggtgcgt
cagctcaagccgctgctgccgtacagcggcacgtag

DBGET integrated database retrieval system