KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0348Help
Entry
DvMF_0348         CDS       T00816                                 

Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DvMF_0348
   01230 Biosynthesis of amino acids
    DvMF_0348
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DvMF_0348
   00051 Fructose and mannose metabolism
    DvMF_0348
   00562 Inositol phosphate metabolism
    DvMF_0348
Enzymes [BR:dvm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DvMF_0348
Exosome [BR:dvm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DvMF_0348
  Exosomal proteins of bladder cancer cells
   DvMF_0348
  Exosomal proteins of melanoma cells
   DvMF_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
406726..407481
Genome map
AA seq 251 aa AA seqDB search
MKKLMAANWKMYKTAGEARTTAASLAALTADTLPDDREVVIFPQFTALSPVADALRHATG
YSVGGQDVYPAAEGAYTGEISPGMLMDCGCAWVLTGHSERRHVIGESDELVGAKTAFSIN
AGLKVVLCIGETIEEREAGRLGEVLERQLETGLAGVKGDAVPAAIAVAYEPVWAIGTGKV
AGPPEIVEAHALVRQLLVARFGEGGVAVRILYGGSVKPENAREIIALDNVDGVLVGGASL
QADSFSRIILA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcatggccgccaactggaagatgtacaagactgccggggaagcgcggacc
accgcagcctcgctggcggcgttgacggcggacacgctgccggacgaccgcgaggtggtg
atctttccgcaattcaccgcgctgtcgcccgtggccgacgcgctgcgccacgccaccgga
tattcggtcggcgggcaggacgtgtacccggcggcggaaggcgcctacaccggagaaatt
tcaccgggcatgctcatggactgcgggtgcgcctgggtgcttaccggccattccgagcgc
cgccatgtcatcggcgaaagcgatgaactggtgggcgccaagaccgcgttcagcatcaat
gccggactcaaggtggtgctgtgcatcggcgagaccatcgaagaacgcgaggcaggccga
ctgggcgaggtgctggagcgccagttggagaccggtctggccggggtgaagggagatgcc
gtgcccgccgccatcgccgtggcctacgaaccggtgtgggccattggtaccggcaaggtg
gccgggccgccggaaatcgtcgaggcgcatgccctggtgcgtcaactgctggtggcccgc
ttcggcgaagggggcgtggcggtgcgcatcctgtatggtggcagcgtcaagcccgagaac
gcccgtgaaatcattgcccttgacaatgtggacggtgtcttggtaggaggcgcttctttg
caggctgactcgttcagtcgcatcattctggcgtaa

DBGET integrated database retrieval system