KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0412Help
Entry
DvMF_0412         CDS       T00816                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(481260..481907)
Genome map
AA seq 215 aa AA seqDB search
MLDMKRNRERMVKQQLETRGITDPAVLAAMRSVPRHLFVQEALRAQAYEDHPLPIGYGQT
ISQPFIVALMSQIIEPQPGLRVLEIGTGSGYQAAVLAEMGLDVYTVERIRELHAAARDLL
RTLKYRKVRLKLDDGTLGWPEAAPYDRILVTAGGPEVPLPLIEQLADPGIMVIPVGASKR
MQELVVVRKQGGRVVRESKGGVAFVDLVGTHGWRG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatgaagcgcaaccgtgagcgcatggtgaaacagcagctcgagacgcgcggc
atcaccgatccggccgtacttgcggccatgcgttccgtgccgcgtcacctgttcgtgcag
gaagccctgcgcgcacaggcctacgaggaccaccccctgcccataggatatggacagacc
atttcgcagccgttcatcgtggcgctcatgtcgcagatcatcgagccgcaaccgggcctg
cgcgtgctggaaataggcaccggctccggctaccaagccgccgtgctggcggaaatgggc
ctggacgtgtacacggtggaacgcatccgcgaactgcacgccgccgcgcgcgacctgctg
cgcacgctgaagtaccgcaaggtgcggctgaagctggacgacggcaccctgggctggccc
gaagccgccccctacgaccgcatcctggtcacggcgggcgggccggaagtgccgctgccg
ctcatcgagcaactggcggacccgggcatcatggtcattcccgtgggggccagcaagcgg
atgcaggaactggtcgtggtgcgcaagcagggcggacgcgtggtgcgcgaaagcaagggc
ggcgtggccttcgtggacctggtgggcacccacggctggcgcggctag

DBGET integrated database retrieval system