KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0486Help
Entry
DvMF_0486         CDS       T00816                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DvMF_0486
Enzymes [BR:dvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DvMF_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
570277..571266
Genome map
AA seq 329 aa AA seqDB search
MSTHATPAPGVVTLHAGCKVNLYLRITGVRPDGYHELDTLFLPLPEPCDLLHVSPRAEAG
IVFTCTEPDVDPARNTVVTAYERFAAATGFRPGLAVHLEKHIPHGAGLGGGSADAAVLLR
HLAALCAQQAPGAAPTPEALRAMAAGVGADVPFFLMDGPARASGIGVVLTPLAPGELADL
GLAGMHLVLACPPVRVSTPWAYRAWDAANVTTPDDNAQTSTRTSAQNSARMMTGQSAKSL
RPCLTSESLEDRNPLSRGPWLTNSFEPVVFQTHATLRRTKEFLLRRGGCAALMSGSGASL
FALFRKHGTARDVAEALRNDNIAAFLHAL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacccacgccacgcccgcgcccggcgtagtcaccctgcacgcgggatgcaaggtc
aacctgtacctgcgcatcaccggcgtgcgacccgacggctaccacgaactggacaccctg
ttcctgcccctgccggaaccgtgcgacctgctgcacgtgtcgcccagggcggaagcgggc
atcgtcttcacctgcaccgaaccggacgtggacccggcccgcaacaccgtggtcaccgcg
tacgagcggttcgcagcggccaccgggtttcgccccggacttgcggtgcaccttgagaaa
cacattccgcacggggccggccttggcggcggcagcgccgacgccgcagtgctgctgcgc
caccttgccgcgctgtgcgcgcagcaggcccccggcgcggcccccacgcccgaagccctg
cgggccatggccgccggggttggcgccgacgtgcccttctttctgatggatggccccgca
cgggccagcggcatcggcgtggtgctcaccccgctcgcccccggcgaactcgccgacctc
gggctggcgggcatgcatctggtgctggcctgcccgcccgtgcgcgtttccacgccgtgg
gcctatcgggcgtgggatgccgccaacgtcaccaccccagacgacaacgcccagaccagt
acccggaccagtgcccagaacagtgcccggatgatgaccgggcaaagcgcgaaatcattg
cgtccttgcttgacatcggaaagtctagaagatagaaatccactctctcgcggaccgtgg
ctgaccaacagctttgaaccggttgtttttcagacacatgcaaccctgcgccggaccaag
gaatttcttcttcgacgcgggggctgtgccgcgctgatgagcgggagtggcgccagcctg
ttcgccctgttcagaaagcacggcacggcgcgtgatgtggccgaagcactgcgcaacgac
aacatcgcggcctttttgcacgcactgtga

DBGET integrated database retrieval system