KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0525Help
Entry
DvMF_0525         CDS       T00816                                 

Definition
quinolinate synthetase
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DvMF_0525
Enzymes [BR:dvm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     DvMF_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
619280..620329
Genome map
AA seq 349 aa AA seqDB search
MTAQPSQKERIAALRAALGPDLTIMGHHYQHESVIRHTDLRGDSLELARRVADTDAASIV
FCGVYFMAESAALLARPGQKVYLPEHSANCVMAQMAPAERVDAVLRALQADGRKVVPLAY
VNTSLAVKAVVGRHGGAVCTSANARTMLEWTRSQGDAVLFLPDKNLARNTANLLGIPVEK
RHMLDVRAASFRADVLTDEARRAELLIWPGCCAIHARFNLRQMETARAAHPGCRIVVHPE
CSPEVVNAADAAGSTTTIIRFAEAAPDGSTVIVGTEINLVRRLARQHAGRLTVLPLLESA
CSHMARVTEPKLLHTLEGVAAGTEAPVTVPMDLHEPAKAALQRMLDACA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagccctcccagaaagagcgcatcgccgcgctgcgcgccgcgctcggcccc
gacctgaccatcatgggccaccactaccagcacgaatcggtcatccggcacaccgacctg
cgtggcgactcgctggaactggcccgccgcgtggccgacacggacgccgccagcatcgtg
ttctgcggggtgtacttcatggcggaatccgcagccctgctggcgcggcccggccagaag
gtgtacctgccggagcattccgccaactgcgtcatggcccagatggccccggcggaacgg
gtggacgcggtgctgcgcgcccttcaggccgatggccgcaaggtggtgccgctggcctac
gtgaacacctcgctggccgttaaggccgtggtggggcggcacggcggcgcggtgtgcaca
tccgccaacgcgcgcaccatgctggaatggacccgcagccaaggcgacgccgtgctgttt
ttgccggacaagaacctggcccgcaacaccgcgaacctgctgggcatacccgtagaaaaa
cggcacatgctggacgtgcgggccgccagttttcgcgccgacgtgctgaccgacgaggcc
cgccgggcggaactgctgatctggcccggctgctgcgccatccacgcccggttcaacctg
cgccagatggaaacggcccgcgccgcccaccccggctgccgcatcgtggtgcatccggaa
tgttcgccagaggtggtcaacgccgccgatgccgccgggtccaccaccaccatcatccgc
tttgccgaagcggccccggacggctccaccgtcatcgtgggcacggaaatcaacctcgtg
cggcggctggcccgccagcatgccgggcggctgaccgtgctgcccctgctggaaagcgcc
tgttcgcacatggcccgcgtgaccgagcccaaactgctgcacaccctggagggcgtggcg
gcgggcacggaagccccggtcaccgtgcccatggacctgcacgaacccgccaaggcagcc
ctgcaacgcatgctggacgcctgtgcctga

DBGET integrated database retrieval system