KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0525Help
Entry
DvMF_0525         CDS       T00816                                 

Definition
(GenBank) quinolinate synthetase complex, A subunit
  KO
K03517  quinolinate synthase [EC:2.5.1.72]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00760  Nicotinate and nicotinamide metabolism
dvm01100  Metabolic pathways
Module
dvm_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DvMF_0525
Enzymes [BR:dvm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     DvMF_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NadA HCV_capsid
Motif
Other DBs
NCBI-ProteinID: ACL07482
UniProt: B8DKQ3
Position
619280..620329
Genome map
AA seq 349 aa AA seqDB search
MTAQPSQKERIAALRAALGPDLTIMGHHYQHESVIRHTDLRGDSLELARRVADTDAASIV
FCGVYFMAESAALLARPGQKVYLPEHSANCVMAQMAPAERVDAVLRALQADGRKVVPLAY
VNTSLAVKAVVGRHGGAVCTSANARTMLEWTRSQGDAVLFLPDKNLARNTANLLGIPVEK
RHMLDVRAASFRADVLTDEARRAELLIWPGCCAIHARFNLRQMETARAAHPGCRIVVHPE
CSPEVVNAADAAGSTTTIIRFAEAAPDGSTVIVGTEINLVRRLARQHAGRLTVLPLLESA
CSHMARVTEPKLLHTLEGVAAGTEAPVTVPMDLHEPAKAALQRMLDACA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagccctcccagaaagagcgcatcgccgcgctgcgcgccgcgctcggcccc
gacctgaccatcatgggccaccactaccagcacgaatcggtcatccggcacaccgacctg
cgtggcgactcgctggaactggcccgccgcgtggccgacacggacgccgccagcatcgtg
ttctgcggggtgtacttcatggcggaatccgcagccctgctggcgcggcccggccagaag
gtgtacctgccggagcattccgccaactgcgtcatggcccagatggccccggcggaacgg
gtggacgcggtgctgcgcgcccttcaggccgatggccgcaaggtggtgccgctggcctac
gtgaacacctcgctggccgttaaggccgtggtggggcggcacggcggcgcggtgtgcaca
tccgccaacgcgcgcaccatgctggaatggacccgcagccaaggcgacgccgtgctgttt
ttgccggacaagaacctggcccgcaacaccgcgaacctgctgggcatacccgtagaaaaa
cggcacatgctggacgtgcgggccgccagttttcgcgccgacgtgctgaccgacgaggcc
cgccgggcggaactgctgatctggcccggctgctgcgccatccacgcccggttcaacctg
cgccagatggaaacggcccgcgccgcccaccccggctgccgcatcgtggtgcatccggaa
tgttcgccagaggtggtcaacgccgccgatgccgccgggtccaccaccaccatcatccgc
tttgccgaagcggccccggacggctccaccgtcatcgtgggcacggaaatcaacctcgtg
cggcggctggcccgccagcatgccgggcggctgaccgtgctgcccctgctggaaagcgcc
tgttcgcacatggcccgcgtgaccgagcccaaactgctgcacaccctggagggcgtggcg
gcgggcacggaagccccggtcaccgtgcccatggacctgcacgaacccgccaaggcagcc
ctgcaacgcatgctggacgcctgtgcctga

DBGET integrated database retrieval system