KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0763Help
Entry
DvMF_0763         CDS       T00816                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DvMF_0763
   01230 Biosynthesis of amino acids
    DvMF_0763
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DvMF_0763
   00030 Pentose phosphate pathway
    DvMF_0763
   00051 Fructose and mannose metabolism
    DvMF_0763
   00052 Galactose metabolism
    DvMF_0763
  Energy metabolism
   00680 Methane metabolism
    DvMF_0763
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    DvMF_0763
Enzymes [BR:dvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DvMF_0763
Protein phosphatases and associated proteins [BR:dvm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DvMF_0763
Messenger RNA biogenesis [BR:dvm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DvMF_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
910188..911534
Genome map
AA seq 448 aa AA seqDB search
MPSTHFDNGVLQLDTTIPVLGPAKIPTPLCYGSYADEQGIPLFLDREHIAELGAESVPLQ
FEPAGPRSHLYFDSSKTKCAIVTCGGLCPGINDVIRAIVMEAYHAYNVPAVIGIRYGLEG
FIPKYRHEFMELTPDKVSDIHQFGGTILASSRGPQSPEEVVDALERMNVSALFMIGGDGT
MRAASGIVAEIARRNLRISVIGIPKTIDNDINFISQSFGFETAVYKATEAIQCAHVEALG
AMNGVGLVKLMGRESGFIAAHATLSLKEVNFVLIPEVRFALHGEGGLLPALEKRLRSRAH
AVIVVAEGAGQHLLEGTGETDASGNPILGDIATLLRSEIKRYCDERSLPYALKYIDPSYI
IRSVPANANDRVYCGFLGQHAVHAAMAGRTGMVVSKLMDRYVHLPLDLVTRTRRKLNVAS
DYWRAVLESTGQVDLAGMVPDTTRACPI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgacccatttcgacaacggcgtcctgcaactggacaccaccattcccgtcctg
ggaccggccaagatacccaccccgctctgctacggcagctacgccgacgaacagggcatc
cccctgttcctcgaccgcgagcacatcgccgaactgggcgctgaatccgtccccctgcag
ttcgaacccgccgggccgcgcagccacctgtatttcgattcttccaagaccaagtgcgcc
atcgtcacctgcggcggcctgtgccccggcatcaacgacgtcatccgggccatcgtcatg
gaggcgtaccacgcctacaacgtgcccgccgtcatcggcatccgttacgggctggaaggg
ttcatccccaagtaccgccacgaattcatggaactgaccccggacaaggtctcggacatc
caccagttcggcggcaccatcctggcctcgtcgcgcgggccgcagtcgcccgaagaggtg
gtggacgcgctggagcgcatgaacgtcagcgccctgttcatgatcggcggcgacggcacc
atgcgcgcggcatcgggcatagtggccgaaatcgcgcgacgcaacctgcgcatctcggtc
atcggcatccccaagaccatcgacaacgacatcaatttcatcagccagtcgttcggcttc
gaaaccgccgtgtacaaggccacggaagccatccagtgcgcccacgtggaggcgttgggg
gccatgaacggcgtggggctggtcaagctgatgggtcgcgaatcgggcttcatcgccgcg
cacgccaccctttcgctgaaggaagtgaacttcgtgctcattcccgaggtgcgctttgcc
ctgcacggcgaagggggcctgctgcctgcgctggaaaagcggctgcgttcgcgcgcccac
gccgtcatcgtggtggcggaaggcgcgggccagcacttgctggaaggcaccggcgaaacc
gacgcctcgggcaaccccatcctgggcgatatcgccacgctgctgcgctcggaaatcaag
cgctactgcgacgaacgctcgctgccgtacgcactgaagtacatcgaccccagctacatc
atccgttccgtgcccgccaacgccaacgacagggtgtactgcggctttctgggccagcac
gccgtgcacgccgccatggccgggcgcaccggcatggtggtgtccaagctgatggaccgc
tacgtgcacctgccgctggacctggtgacgcgcacccggcgcaagctgaacgtggcgtcc
gactactggcgggcggtgctggagtccaccgggcaggtggatctggcggggatggtgccg
gataccacccgagcctgccccatttga

DBGET integrated database retrieval system