KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0780Help
Entry
DvMF_0780         CDS       T00816                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DvMF_0780
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DvMF_0780
Enzymes [BR:dvm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DvMF_0780
Two-component system [BR:dvm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DvMF_0780
Bacterial motility proteins [BR:dvm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DvMF_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(936260..937402)
Genome map
AA seq 380 aa AA seqDB search
MITVVVVDDSAFMRKALSSMLEKDPEISVVAVGRDGEEGLELVRKHNPDVVTLDIEMPRM
DGLTALRRIMMEMPRPVLMVSSLTTEGAESTLKALELGAVDFIPKQLSKVSLDIVRIEDE
LREKVKEISRRKFLRTPRSLRAPRPMGDGGASTSSSSGATGYGGAGGTGGGAPSGGEGPR
PVLTPRAGRPVRDIVAIGVSTGGPPAVQKVLSQLPADFPASILIAQHMPAAFTGPFAKRL
DGVCRISVKEAENGERLRPGTAYIAPGGKHLRVDQKISMVEVVVTPEPAEALYKPSANVL
IESVAQAMGRRTLGVILTGMGSDGLEGVRVLKQKGGRALAQSDATCVVYGMPKAIVDAGL
ADEIIDIDDMASAIMAGLYK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacggttgtcgttgttgatgattccgccttcatgcgcaaggcgctttccagcatg
ctcgaaaaagaccctgaaatcagcgtggtggccgtgggccgcgacggtgaggaagggctt
gaactggtgcgcaagcacaacccggacgtggtgaccctggacatcgaaatgccgcgcatg
gacgggttgaccgcgttgcgccgcatcatgatggaaatgccccgcccggtgctgatggtc
agttcgctgaccaccgaaggggccgaatccaccctgaaggccctggaactgggcgccgtg
gacttcattcccaagcagctgtccaaggtttcgctcgatatcgtgcgcatagaagatgaa
ctgcgcgagaaggtgaaggaaatttcgcgccgcaagtttctgcgcactccccgttcgttg
cgcgccccccgccccatgggcgacgggggcgcttccacctcttcttcctcgggggcaacg
ggatacgggggggctgggggaactggcggcggtgcgccatccggcggcgaaggtccgcgc
ccggtgcttaccccccgcgcggggcgtccggtgcgcgacatagtggccatcggcgtttcc
accggcgggccgcccgccgtgcagaaggtgctgtcgcagcttcccgcggactttcccgcc
agcatcctcattgcccagcacatgcccgccgcgtttaccggcccctttgccaagcggctg
gacggcgtgtgccgcatctcggtgaaagaggcggaaaatggcgagcgcctgcgccccggc
accgcgtacatcgcgcccggcggcaagcatttgcgggtggatcagaagatcagcatggta
gaagtggtggttacccccgaaccggcagaggcgctgtacaagccttcggccaacgtgctc
atcgaatcggtggcgcaggccatgggccgccgcaccctgggggtcatccttaccggcatg
ggcagcgacggcctggaaggcgtgcgcgtgctgaagcagaagggcggcagggcgttggcg
caaagcgacgccacctgcgtggtctacggcatgcccaaggccatcgtggatgccgggctg
gccgatgaaatcatagacatagacgacatggcctctgccataatggcggggctgtacaaa
tag

DBGET integrated database retrieval system